KEGG   Paracoccus denitrificans: Pden_4499Help
Entry
Pden_4499         CDS       T00440                                 

Definition
(GenBank) homoserine O-succinyltransferase
  KO
K00651  homoserine O-succinyltransferase/O-acetyltransferase [EC:2.3.1.46 2.3.1.31]
Organism
pde  Paracoccus denitrificans
Pathway
pde00270  Cysteine and methionine metabolism
pde00920  Sulfur metabolism
pde01100  Metabolic pathways
pde01110  Biosynthesis of secondary metabolites
pde01130  Biosynthesis of antibiotics
pde01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pde00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Pden_4499
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Pden_4499
Enzymes [BR:pde01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     Pden_4499
    2.3.1.46  homoserine O-succinyltransferase
     Pden_4499
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTS
Motif
Other DBs
NCBI-ProteinID: ABL72563
UniProt: A1BAL9
Position
2:1714056..1714982
Genome map
AA seq 308 aa AA seqDB search
MPITLPNDLPAYDILSNEGVMVMSPGRAATQDIRPLRIGLLNLMPKKIQTENQFARLIGA
TPLQIDFQLIRMSDHESRNTAADHLQSFYRRFCEVEETGEKFDGLIITGAPIEHLPFEEV
TYWEELTRVFRWTQSHVHSTFGVCWGGMAMAWHFHRLEKHMLDHKAFGCFRHRNLVPASP
YLRGFSDDVLVPVSRWTEVRQDEVDAIPALQTLIASDQVGPCLLQDTGHRALYVFNHFEY
DSTTLKDEYDRDVVSGKPINVPVNYYPDDDPSRAPTNRWRSHAHLLYGNWINEIYQTTHF
DLNRIGEA
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgcccatcaccctgcccaatgacctgcccgcctatgacatcctgtcgaacgaaggcgtc
atggtcatgtcgccgggccgggcggcgacgcaggacatccggccgctgcgcatcgggctg
ctgaacctgatgcccaagaagatccagaccgagaaccagttcgcccggctgatcggcgcc
acgcccctgcagatcgacttccagctgatccgcatgtcggaccacgaaagccgcaacacg
gcggccgatcacctgcaatccttctaccgccgcttctgcgaggtcgaggagacgggcgag
aagttcgacggtctcatcatcaccggcgcgcccatcgagcacctgcccttcgaagaggtg
acctattgggaggaactgacgcgggtctttcgatggacgcaaagccatgtgcattcgacc
ttcggcgtctgctggggcggcatggcgatggcgtggcatttccatcgcctcgaaaagcac
atgctggaccacaaggccttcggctgcttccgccaccgcaacctggtgccggccagcccc
tatctgcgcggcttttccgacgacgtgctggtcccggtcagccgctggaccgaggtgcgc
caggacgaggtggatgccatcccggcgctgcagacgctgatcgcctcggaccaggtcggg
ccgtgcctgctgcaggacacgggccatcgcgcgctctatgtcttcaaccatttcgaatat
gacagcacgacgctgaaggacgaatacgaccgcgacgtggtctcgggcaagccgatcaac
gtgccggtgaactactacccggacgacgatccctcgcgcgcgccgacgaaccgctggcgc
agccatgcgcatctgctctacggtaactggatcaacgagatctaccagaccacccatttc
gacctgaaccgcatcggcgaggcgtaa

DBGET integrated database retrieval system