KEGG   Paracoccus denitrificans: Pden_5022Help
Entry
Pden_5022         CDS       T00440                                 

Definition
(GenBank) 3-oxoadipyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pde  Paracoccus denitrificans
Pathway
pde00071  Fatty acid degradation
pde00072  Synthesis and degradation of ketone bodies
pde00280  Valine, leucine and isoleucine degradation
pde00310  Lysine degradation
pde00362  Benzoate degradation
pde00380  Tryptophan metabolism
pde00620  Pyruvate metabolism
pde00630  Glyoxylate and dicarboxylate metabolism
pde00640  Propanoate metabolism
pde00650  Butanoate metabolism
pde00900  Terpenoid backbone biosynthesis
pde01100  Metabolic pathways
pde01110  Biosynthesis of secondary metabolites
pde01120  Microbial metabolism in diverse environments
pde01130  Biosynthesis of antibiotics
pde01200  Carbon metabolism
pde01212  Fatty acid metabolism
pde02020  Two-component system
Module
pde_M00373  Ethylmalonyl pathway
Brite
KEGG Orthology (KO) [BR:pde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Pden_5022
   00630 Glyoxylate and dicarboxylate metabolism
    Pden_5022
   00640 Propanoate metabolism
    Pden_5022
   00650 Butanoate metabolism
    Pden_5022
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Pden_5022
   00072 Synthesis and degradation of ketone bodies
    Pden_5022
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Pden_5022
   00310 Lysine degradation
    Pden_5022
   00380 Tryptophan metabolism
    Pden_5022
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Pden_5022
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Pden_5022
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Pden_5022
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pde04147]
    Pden_5022
Enzymes [BR:pde01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Pden_5022
Exosome [BR:pde04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Pden_5022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABL73082
UniProt: A1BC38
Position
p1:532708..533907
Genome map
AA seq 399 aa AA seqDB search
MTEVFICDYIRTPIGRFGGALSSVRADDLGAIPLRALMARHAGLDWQAVDDVIYGCANQA
GEDNRNVARMSALLAGLPVEVPGTTINRLCGSGMDAVLVAARQIAAGEAELMIAGGVESM
SRAPFVLPKAESAFSRHAEIHDTTIGWRFVNPAMHAAYGTDSMPQTGQNVADDYGISREA
QDAMALASQQKAAAAIASGRLAAEIAPITIPQRKGEPIVVDTDEHPRATTPEALAKLRPL
FPNGSVTAGNASGVNDGAAALILASEAAARKHGLTPIARVLGGATAGVPPRIMGIGPAPA
SQKLMDRLGLTPADFDVIELNEAFAAQGLATLRQLGIADDDPRVNPNGGAIALGHPLGMS
GARITGTAALELALTGGKRSLSTMCIGVGQGIAVALERV
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagtctttatctgcgactatatccgcacgcccatcggccggtttggcggcgcg
ctgtcctcggtgcgcgccgacgatctgggtgccatccccttgcgcgcgctgatggcacgc
catgccggcctcgactggcaggcggtggacgacgtgatctatggctgcgccaaccaggcc
ggcgaggacaaccgcaacgtcgcccgcatgtcagcgctgctggccgggctgccggtcgag
gtgccaggcacgacgatcaaccggctctgcggctcgggcatggacgcggtgctggtcgcc
gcgcgccagatcgcggcgggcgaggccgagctgatgatcgccggcggcgtcgagtcgatg
tcgcgcgcgcccttcgtgctgcccaaggccgaaagcgccttcagccgccatgccgagatc
cacgacaccaccatcggctggcgcttcgtgaacccggcgatgcatgcggcctatggcacc
gactcgatgccgcagaccggccagaacgtcgccgacgactacggcatctcgcgcgaggcg
caggacgcgatggcgctggcctcgcagcagaaggccgcggcggccatcgccagcggccgg
ctcgcagccgagatcgcgccgatcacgatcccgcagcgcaagggcgagcccatcgtggtc
gataccgacgagcatccccgcgccaccacgcccgaggcgctggccaagctgcgaccgctg
ttcccgaacggctcggtcacggccggcaatgcctcgggggtgaacgacggggcggcggcg
ctgatcctggcctcggaggcggcggcgaggaagcatggactgacgcccatcgcccgcgtg
ctgggcggggcgacggcgggcgtgccgccgcgcatcatgggcatcggcccggcgccggcc
tcgcaaaaactgatggatcggctgggcctgaccccggccgatttcgacgtgatcgagctg
aatgaggccttcgccgcccagggcctcgccacgctgcgccagctgggcatcgccgacgac
gacccgcgcgtgaacccgaacggcggcgccatcgcgctggggcatccgctgggcatgtcg
ggcgcccggatcaccggcaccgcggcgctggaactggcgctgacgggtggcaaacgctcg
ctctcgaccatgtgcatcggggtgggacaaggcatcgccgtggcgctggaaagggtctga

DBGET integrated database retrieval system