KEGG   Clostridioides difficile 630Derm: CD630DERM_10600Help
Entry
CD630DERM_10600   CDS       T03785                                 

Definition
(GenBank) putative pseudouridylate synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
pdf  Clostridioides difficile 630Derm
Brite
KEGG Orthology (KO) [BR:pdf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:pdf03009]
    CD630DERM_10600
Enzymes [BR:pdf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     CD630DERM_10600
Ribosome biogenesis [BR:pdf03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    CD630DERM_10600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: CEJ97619
Position
1:1258422..1259324
Genome map
AA seq 300 aa AA seqDB search
MFKKENQRYNLISYTNEEEMTLKEVLLDKLNFSVRSLSKMKREKSVLVNGVYKKPSLKVY
SGDLIEVKIYEEKANFEPQDLNLQIIYDDFDIIMVNKPPFMVVHPTKSHYDKTIANGISY
YIDNQKENVKIRFVNRLDMNTSGLVIVAKNAYAHHTLSTAMSENKVEKKYITVVDGIIKE
NEGTIDEPIYRPTEDSIKRIIDERGQSSVTHYKVIERLENATVLEVSLETGRTHQIRVHM
AHIGHGIIGDELYGYVDEELINRQALHAYKLEFEQPRTKEKLKFKADIPEDMKELISKLR
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
ttgtttaaaaaagagaatcaaagatataatcttatatcgtatacaaatgaagaagaaatg
actttaaaagaagttttattggacaagctaaatttctcagttaggtcattatcaaaaatg
aagagggaaaagagtgttttagtaaatggagtatataaaaaaccgagtttaaaggtgtat
agtggtgatttaatagaagtaaaaatatacgaggaaaaagcaaattttgaacctcaagat
ttaaatttacagataatttatgatgattttgatataattatggtgaataaacctccgttt
atggtagttcacccaacaaaaagccactatgataaaacaatagcaaatggtattagttac
tatatagataatcaaaaagaaaacgtaaaaataagatttgtaaataggttagatatgaat
acttcagggttagttatagtagcaaaaaatgcttatgcacatcatactttgtctacagca
atgagtgaaaataaagttgaaaaaaagtatataacagtagttgatggaattataaaagaa
aatgagggaactatagatgagccaatttatagacctacagaagattcaataaagaggata
atagatgaaagaggacagtcatctgttactcactataaagtaatagaaagactagaaaat
gcaactgtattagaagtaagcttagaaactggtagaacacatcaaataagagtacatatg
gctcatataggtcatggaataataggtgatgagttgtatggttatgtagatgaagagcta
ataaataggcaagcacttcatgcatataagttagagtttgaacaaccaagaacaaaagaa
aaattgaaatttaaagcagatataccagaggatatgaaagagttaatatcgaaattaaga
taa

DBGET integrated database retrieval system