KEGG   Clostridioides difficile 630Derm: CD630DERM_23310Help
Entry
CD630DERM_23310   CDS       T03785                                 

Gene name
mtlD
Definition
(GenBank) Mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
pdf  Clostridioides difficile 630Derm
Pathway
pdf00051  Fructose and mannose metabolism
pdf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    CD630DERM_23310 (mtlD)
Enzymes [BR:pdf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     CD630DERM_23310 (mtlD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh Pneumo_ncap DUF4974
Motif
Other DBs
NCBI-ProteinID: CEJ98949
Position
1:complement(2652209..2653360)
Genome map
AA seq 383 aa AA seqDB search
MKKAIQFGAGNIGRGFIGGLLVKSGYHVVFADVNEYILNSINKDKKYTIHIRDVECIDEV
IDNISAVSSIKEEIIDEIVQAEIITTAVGPLVLTKIASTIAKGIKARKEKGLTSNLNIIA
CENAIYASSSLKEEVLKYLNKEEVEYLEMYVGFPNCSVDRIVPPGKNENPLDVTVENFYE
WNVEKQGFKGEIPTIVGMNLADNLMAYIERKLFTLNTGHAITAYIGYLKGYKTIEESIKD
KFICDIVKSAMVESGEGLIKKYNFDSEVHYKYIDKILNRFKNPYLNDDVLRVGREPLRKL
SDKDRLIKPLMTAKSYGLSVDNLILGIGAALHYNNSEDTQSVELQELIKSIGVKKAVAKI
ANISNDEELLNNIEKSYIFMKNL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaggcaattcagtttggagcaggaaatattggaaggggttttattggaggcttg
ttagttaagtcgggttatcatgtagtatttgctgatgtaaatgagtatatattaaactca
ataaacaaagataaaaagtatactatacacataagagatgtagaatgtatagatgaagta
attgataatataagtgcggtttcatctataaaagaagaaataatagatgagattgtacag
gctgaaataataactacagcagttggacctttagttttgactaaaatagcctctacaatt
gcaaaaggtataaaagctagaaaagaaaagggattaacaagtaatctaaatataatagca
tgtgaaaatgcaatatacgcaagttcttctttaaaagaagaggtacttaagtatttaaat
aaggaagaagtagaatatttagagatgtatgttggttttccaaactgttcagttgataga
atagttcctcctggtaaaaacgaaaatcctcttgatgtaacagttgaaaatttttatgag
tggaatgttgaaaaacaaggatttaaaggggaaataccaactatagttggaatgaattta
gctgataatcttatggcttatatagaacgtaaattgtttacactgaatacaggtcatgct
ataacagcttatataggatatttaaaaggatataagactatagaagagagtataaaagat
aaatttatctgtgatatagtcaaaagtgcaatggtagaaagtggagaaggattgattaaa
aaatacaattttgactcagaagtgcactataaatatattgataaaattttaaatagattt
aaaaatccatatcttaatgatgatgtattaagagtcggaagggaaccattaagaaaacta
agtgataaagatagattgattaaacctttaatgacagcaaaatcatatggattatcagtt
gataatttgattcttggaataggtgcagcgcttcattataataatagtgaagatactcaa
agtgtagaattacaagagttgataaagtctattggggtaaaaaaagctgttgctaaaata
gctaatataagcaatgacgaagaacttttaaataatatcgaaaaaagttatatatttatg
aaaaatttataa

DBGET integrated database retrieval system