KEGG   Clostridioides difficile 630Derm: CD630DERM_26760Help
Entry
CD630DERM_26760   CDS       T03785                                 

Gene name
thlA2
Definition
(GenBank) Acetoacetyl-CoA thiolase 2
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pdf  Clostridioides difficile 630Derm
Pathway
pdf00071  Fatty acid degradation
pdf00072  Synthesis and degradation of ketone bodies
pdf00280  Valine, leucine and isoleucine degradation
pdf00310  Lysine degradation
pdf00362  Benzoate degradation
pdf00380  Tryptophan metabolism
pdf00620  Pyruvate metabolism
pdf00630  Glyoxylate and dicarboxylate metabolism
pdf00640  Propanoate metabolism
pdf00650  Butanoate metabolism
pdf00900  Terpenoid backbone biosynthesis
pdf01100  Metabolic pathways
pdf01110  Biosynthesis of secondary metabolites
pdf01120  Microbial metabolism in diverse environments
pdf01130  Biosynthesis of antibiotics
pdf01200  Carbon metabolism
pdf01212  Fatty acid metabolism
pdf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pdf00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CD630DERM_26760 (thlA2)
   00630 Glyoxylate and dicarboxylate metabolism
    CD630DERM_26760 (thlA2)
   00640 Propanoate metabolism
    CD630DERM_26760 (thlA2)
   00650 Butanoate metabolism
    CD630DERM_26760 (thlA2)
  Lipid metabolism
   00071 Fatty acid degradation
    CD630DERM_26760 (thlA2)
   00072 Synthesis and degradation of ketone bodies
    CD630DERM_26760 (thlA2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CD630DERM_26760 (thlA2)
   00310 Lysine degradation
    CD630DERM_26760 (thlA2)
   00380 Tryptophan metabolism
    CD630DERM_26760 (thlA2)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CD630DERM_26760 (thlA2)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CD630DERM_26760 (thlA2)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CD630DERM_26760 (thlA2)
Enzymes [BR:pdf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CD630DERM_26760 (thlA2)
Exosome [BR:pdf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CD630DERM_26760 (thlA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Ketoacyl-synt_C
Motif
Other DBs
NCBI-ProteinID: CEJ99299
Structure
PDB: 

Position
1:3049382..3050560
Genome map
AA seq 392 aa AA seqDB search
MKDVVIVSAVRTPIGSFGGVFKNTSAVQLGTIAVKEAISRVGLNLSEIDEVIIGNVLQTG
LGQNVARQIAINAGIPNSVPSYTVNKLCGSGLKSVQLAAQSITSGENDVVIAGGTENMSQ
APYIVPTARFGSKMGNITMVDSMLTDGLIDAFNQYHMGITAENIATKFEFTREMQDKLAL
ESQNKAENAIKNNRFKEEIVPVDVLIRRGKIETIDKDEYPKLGMTFEGLSKLKPAFKKDG
TVTAGNASGINDGAAMLILMSQQKADELGIRPLAKIKSYASAGVEPEVMGTGPIPATRKA
LKKAGLSINDIDLIEANEAFAAQALAVKNELQIDSSKLNVNGGAIALGHPIGASGARILV
TLIYEMQKRKVETGLATLCIGGGQGISMVVSR
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgtagtaatcgtatcagcagtcagaacacctataggaagttttggaggtgta
tttaaaaatacttcagctgttcaacttggaactatcgctgttaaagaagcgatatcacgt
gtaggacttaatttatctgaaatagatgaagtaataattggaaatgttcttcaaacaggg
cttggacagaatgttgctagacaaattgctataaatgcaggtataccaaattctgttcca
agctacacagtaaataaattatgtggttcagggcttaaaagtgtccagctagctgcccaa
tcaatcacatctggtgaaaatgatgtggtaattgcaggtggtactgaaaatatgagtcaa
gctccttatatcgttccaactgctcgctttggtagtaaaatgggtaacataaccatggta
gatagtatgctaacagatggccttattgatgctttcaatcagtatcatatgggaataact
gcagaaaatattgcaactaaatttgaatttactagagaaatgcaagataaattggcatta
gaaagtcaaaataaggctgagaatgctataaaaaacaaccgctttaaagaagaaatcgtt
ccagtagatgttttaatacgtcgaggaaaaatagaaactattgataaagatgaatatcct
aaattaggtatgacatttgaaggtttatctaaacttaaacctgcattcaaaaaagatggt
actgtaacagctggaaatgcctcaggtattaatgatggtgcggctatgttaatactaatg
agccaacaaaaagcagacgaactaggtattagaccacttgctaaaataaaatcctatgct
tcagctggtgttgaacctgaagtcatgggtactggtccaatccctgcaactagaaaagca
ctgaaaaaagctggacttagcatcaatgatatagacttaatagaagcaaatgaagcgttt
gctgcccaagcattagctgttaaaaatgaacttcaaatagattcatcaaagttaaatgtt
aatggtggtgcaatagcattaggacatccaataggagcaagtggagctagaatacttgtt
accttaatttatgaaatgcaaaaacgtaaagttgaaactggacttgcaacactttgtatt
ggtggtggtcaaggaatatcaatggtggtttcacgatag

DBGET integrated database retrieval system