KEGG   Planococcus donghaensis: BCM40_01575Help
Entry
BCM40_01575       CDS       T04451                                 

Definition
(GenBank) thiaminase II
  KO
K03707  thiaminase (transcriptional activator TenA) [EC:3.5.99.2]
Organism
pdg  Planococcus donghaensis
Pathway
pdg00730  Thiamine metabolism
pdg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdg00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BCM40_01575
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pdg03000]
    BCM40_01575
Enzymes [BR:pdg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     BCM40_01575
Transcription factors [BR:pdg03000]
 Prokaryotic Type
  Other transcription factors
   Others
    BCM40_01575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TENA_THI-4
Motif
Other DBs
NCBI-ProteinID: ANU22105
UniProt: A0A1C7EEH2
Position
complement(2971053..2971736)
Genome map
AA seq 227 aa AA seqDB search
MTFCKEVRKECDHLWQASFDHPFVKGIEDGTLPVDVFRFYVMQDAYYLSHFAKIQALGAS
KAKDLETTQRFAIHASHTSTAELSLHQSFMKMLDVTEKDWLAFQPSPTAYAYVSHMYRAS
AGDLADVLAAILPCYWLYYEIGERLKNAKPDHPIYDRWIETYGSEEFGELVNEQIERMNR
LAEELPEARRKELKDHFLKSSYYELNFWDQAWRKETWSIDAIEKVGV
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgactttttgtaaagaagtaagaaaagaatgtgaccacctatggcaggcgagttttgat
catccatttgttaaaggaattgaagatgggacattgccggtcgatgtattccgtttttac
gtcatgcaagatgcttattacttatcacatttcgcgaaaattcaagcacttggtgcatca
aaagcaaaagacttagaaacaacgcaacgttttgcgattcatgcatcacatacaagtacg
gctgaattatctttacaccaatcctttatgaaaatgttagatgttacggaaaaagattgg
ttagcatttcaaccttctccgactgcatatgcatatgtatctcatatgtaccgagcatct
gcaggggatttagcagacgtcctagcggccattttgccttgttattggctgtattatgaa
atcggcgaacggttgaaaaatgccaaaccggatcatccgatttatgaccgttggattgaa
acttacggttccgaggaatttggggaacttgtcaatgaacaaatcgaacggatgaatcgt
ttggctgaagaactgccagaagctcgccgcaaagaactaaaagaccattttctaaagagc
agttattacgaattaaatttttgggaccaagcatggagaaaagaaacgtggtctatagat
gcgattgaaaaagtaggtgtctaa

DBGET integrated database retrieval system