KEGG   Planococcus donghaensis: BCM40_02320Help
Entry
BCM40_02320       CDS       T04451                                 

Definition
(GenBank) beta-ketoadipyl CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pdg  Planococcus donghaensis
Pathway
pdg00071  Fatty acid degradation
pdg00072  Synthesis and degradation of ketone bodies
pdg00280  Valine, leucine and isoleucine degradation
pdg00310  Lysine degradation
pdg00362  Benzoate degradation
pdg00380  Tryptophan metabolism
pdg00620  Pyruvate metabolism
pdg00630  Glyoxylate and dicarboxylate metabolism
pdg00640  Propanoate metabolism
pdg00650  Butanoate metabolism
pdg00900  Terpenoid backbone biosynthesis
pdg01100  Metabolic pathways
pdg01110  Biosynthesis of secondary metabolites
pdg01120  Microbial metabolism in diverse environments
pdg01130  Biosynthesis of antibiotics
pdg01200  Carbon metabolism
pdg01212  Fatty acid metabolism
pdg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pdg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BCM40_02320
   00630 Glyoxylate and dicarboxylate metabolism
    BCM40_02320
   00640 Propanoate metabolism
    BCM40_02320
   00650 Butanoate metabolism
    BCM40_02320
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BCM40_02320
   00072 Synthesis and degradation of ketone bodies
    BCM40_02320
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BCM40_02320
   00310 Lysine degradation
    BCM40_02320
   00380 Tryptophan metabolism
    BCM40_02320
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BCM40_02320
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BCM40_02320
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BCM40_02320
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pdg04147]
    BCM40_02320
Enzymes [BR:pdg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BCM40_02320
Exosome [BR:pdg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BCM40_02320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C ketoacyl-synt SpoVAD Dodecin
Motif
Other DBs
NCBI-ProteinID: ANU22246
UniProt: A0A1C7EEZ1
Position
complement(2823961..2825142)
Genome map
AA seq 393 aa AA seqDB search
MNNIYLIDGARTAFGGFGGAFVNTDATELGAATAVEALKRSNVKAEDINHIFYGNVIQSS
VNGAYVARHIGLKAGVPKEVPALTLNRLCGSGAQAVVTAAQHILLEEADLVLAGGAENMS
MSPYASFDQRFSKSKMGNIQFEDMLTATLTDQYTGSGMGMTAEKLAEQYNISREEQDAFS
VQSNQRAAQAVESGRFAEEIVAVEVKTRKGVLIVDKDEHIKPDANEEALAKLRPSFKKEG
TVTAGNASGINDGAASLVIASEAAVDKHGLKPMARIVSWGVVGVDPTIMGIGPVPAIKQA
LERAELTVDDIDLFEVNEAFAAQYLAVEKELGLDREKVNVNGGAIALGHPVGASGARILL
SLAYELKHRGGKYGVASLCIGGGQGIAVVIESA
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaataatatttacttaatagatggagcaagaaccgcttttggcggatttggaggagca
ttcgtcaatacggatgcgactgaacttggagcggccacggcagttgaggcgttaaagcgg
tcaaatgtcaaagcagaagatattaatcatattttttatgggaatgttattcaatctagc
gtgaatggcgcttatgttgcccggcatattgggttaaaagcgggtgtgccaaaagaagtt
ccagcgctcacgttaaatcgtttatgtggatcgggtgctcaagcggtcgtgacagccgcg
cagcacatattattagaagaggcggatttggtgttggcaggaggggcagagaacatgtcg
atgtctccatatgctagttttgatcaacgctttagtaaatcgaaaatgggtaatatacaa
tttgaagatatgttaactgccacattgacggatcaatataccggaagcggtatgggtatg
acagcagaaaagctagcagagcaatacaatatctcgcgtgaagaacaagatgctttctct
gtgcagtctaatcagcgagcagcacaagcagtcgaatctggtagatttgcagaagagatt
gtagcggtcgaggtgaaaacgcgtaaaggtgttttaatagtagacaaagatgaacatatt
aaaccagacgcaaatgaagaagctttggcaaaacttcgtccttcgttcaaaaaagaaggt
acggtgacggctgggaacgcttcaggtattaacgacggagcagcttcactcgttatagcg
agcgaagctgctgtagacaagcacggcttaaaaccaatggcgcgtattgtctcttgggga
gtagtaggagtagatccgacgattatgggcattggaccagtgccggcgattaaacaagcg
ttagaacgtgctgagttgactgttgacgatattgatttatttgaagtgaatgaagcattc
gcggcacaatatttggcagtggaaaaagaacttgggttagaccgagaaaaagttaatgtc
aacggcggtgcaattgcattaggacatccagttggagcaagtggtgcacgtatattattg
tcactagcttatgagttgaaacatcgtggcggaaaatatggagtagcgagtttatgtatt
gggggaggacaaggaattgcggtggtgattgaaagtgcttaa

DBGET integrated database retrieval system