KEGG   Planococcus donghaensis: BCM40_05700Help
Entry
BCM40_05700       CDS       T04451                                 

Definition
(GenBank) succinate--CoA ligase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pdg  Planococcus donghaensis
Pathway
pdg00020  Citrate cycle (TCA cycle)
pdg00640  Propanoate metabolism
pdg00660  C5-Branched dibasic acid metabolism
pdg01100  Metabolic pathways
pdg01110  Biosynthesis of secondary metabolites
pdg01120  Microbial metabolism in diverse environments
pdg01130  Biosynthesis of antibiotics
pdg01200  Carbon metabolism
Module
pdg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pdg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pdg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BCM40_05700
   00640 Propanoate metabolism
    BCM40_05700
   00660 C5-Branched dibasic acid metabolism
    BCM40_05700
Enzymes [BR:pdg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BCM40_05700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A Citrate_bind
Motif
Other DBs
NCBI-ProteinID: ANU22888
UniProt: A0A1C7EGH9
Position
complement(2091575..2092735)
Genome map
AA seq 386 aa AA seqDB search
MNIHEYQGKELLRQYGVAVSYGTVAFSPEEAVKAAKELSTDVVVVKAQIHAGGRGKAGGV
KIAKNLDEVRTYAKELLGKVLVTHQTGPEGKEIKRLLIEEGSDIKKEYYIGLVLDRQTAR
VTLMGSEEGGVDIEEVSENTPEKIFKEVIDPVIGLTGFQARRMAFNMNIPPKLVNKAAKF
MLGLYTVFIEKDASIVEINPLVETGDGNILALDAKFDFDENALYRHKDIVELRDFDEEDP
KEIEASKYDLSYISLDGNIGCMVNGAGLAMATMDTINYYGGTPANFLDVGGGATAEKVTE
AFKIILSDKNVKGIFVNIFGGIMKCDIIAEGVIQAAKEVSLEVPLVVRLEGTNVELGKKL
LNESGLNIVAAGTMADGAKQIVELVG
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccatgaatatcaaggtaaagaactcctcagacaatatggcgtagcagtttca
tacggcaccgttgctttttctccagaagaagcagttaaggcagctaaagaactgagtacg
gatgttgtcgtggtaaaagcacaaatccacgcaggtggacgaggcaaagctggcggtgtt
aaaatcgctaaaaatctggacgaagtccgtacatatgcgaaagaacttttaggtaaagtt
cttgtgactcaccagacaggtccagaaggtaaagaaatcaaacgccttttgatcgaagaa
ggatctgacattaagaaggagtattacatcggattggtgcttgaccgccaaactgctcgt
gttactcttatgggctctgaagagggcggagtagatatcgaagaagtttctgaaaacact
cctgaaaaaatctttaaagaagtaatcgatccagtaatcggtttgactggtttccaggca
cgccgtatggctttcaacatgaacattccgccaaagcttgttaacaaagcggcgaaattc
atgcttggactatacactgtatttatcgaaaaagacgcttctatcgttgagattaacccg
ttagttgaaactggcgacggcaatattttagcgcttgatgcgaaattcgatttcgatgaa
aacgctctttaccgccacaaagacattgtggaacttcgcgatttcgacgaagaggatcca
aaagaaattgaagcttctaagtatgacttgagctacatttctttagatgggaacatcggc
tgtatggttaacggcgccggacttgctatggcaactatggacacgatcaactattacggc
ggaacacccgctaacttccttgacgttgggggcggtgccactgctgagaaagtaacggaa
gctttcaaaatcattctttctgataagaatgtaaaaggaattttcgttaacattttcggc
ggtattatgaagtgtgacatcattgcggaaggcgtaattcaagctgctaaagaagtaagc
cttgaagtgccattagtagtccgtcttgaaggaacaaacgtagaacttggtaaaaaactg
cttaatgaatcaggtcttaatatcgtagctgctggaacaatggcagacggcgctaaacag
atcgtagaacttgtaggctaa

DBGET integrated database retrieval system