KEGG   Planococcus donghaensis: BCM40_16155Help
Entry
BCM40_16155       CDS       T04451                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
pdg  Planococcus donghaensis
Pathway
pdg00220  Arginine biosynthesis
pdg00330  Arginine and proline metabolism
pdg01100  Metabolic pathways
pdg01110  Biosynthesis of secondary metabolites
pdg01130  Biosynthesis of antibiotics
pdg01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pdg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    BCM40_16155
   00330 Arginine and proline metabolism
    BCM40_16155
Enzymes [BR:pdg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     BCM40_16155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ANU24909
UniProt: A0A1C7EKN3
Position
pPD76:complement(3270..4178)
Genome map
AA seq 302 aa AA seqDB search
MNKLNISIIGVPMDHGQTRRGVDMGPSAIRYAGVVDRIEELGHRVTDEGDILIGQTDGSV
DTETNLRNLKAITKATEALGDKVFNVAEAGNFPLVLGGDHSIAIGTLAGISERHENLGVI
WYDAHADMNTSDTSPSGNIHGMPLAASFGHGHEKLTNIRGYSPKVKPENIVIIGARSVDP
GERELIKEHGIRVYSMHEIDKMGMHAVIEESIKYLKEERNTDAVHLSLDLDGIDPMYTPG
VGTPVPGGISYRESHLAMEMLFDANIITSAEFVEVNPILDEKNKTADVAVALIGSLFGEK
LL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaataaattaaatatttctattatcggagttccaatggaccacggtcaaactcgtcgt
ggtgttgatatgggaccaagcgctatccgttatgcaggtgttgtagaccgcatcgaagag
ttaggccatcgcgttacagatgaaggggacatcctgattggtcaaacagacggcagtgta
gatacagaaacaaacttacgtaatttgaaagcgattactaaagcaacagaagcgttaggc
gataaagtatttaacgtagcagaagctggaaatttcccattagtattaggtggcgatcac
agtattgcgattggtacacttgctggaatttcagaacgtcacgaaaacttaggcgttatt
tggtatgatgcgcatgcagatatgaacacaagcgatacgtcaccatcaggtaacatccac
ggcatgccgcttgcagcaagctttggacatggtcatgaaaaattgacgaacattcgcggg
tattcaccaaaagtaaaacctgaaaacattgtcatcatcggagctcgttcagtagaccct
ggtgagcgtgaattgatcaaagaacacggcattcgcgtttatagcatgcacgaaattgat
aaaatgggcatgcatgccgtaatcgaagaatcgattaagtacttaaaagaagagcgcaac
acagatgcggttcacttatcattagatcttgatggcattgatccaatgtacacgccaggc
gttgggacacccgttccaggcggcattagctaccgtgaaagccatttagcaatggaaatg
ttgtttgatgcaaacatcattacgtctgctgaatttgtagaagtaaacccgattcttgat
gagaaaaacaaaacagctgatgtagcagttgcgttgatcggttcattgttcggcgaaaaa
ttattataa

DBGET integrated database retrieval system