KEGG   Paenibacillus donghaensis: B9T62_18070Help
Entry
B9T62_18070       CDS       T04971                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
pdh  Paenibacillus donghaensis
Pathway
pdh00051  Fructose and mannose metabolism
pdh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    B9T62_18070
Enzymes [BR:pdh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     B9T62_18070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh NAD_binding_10 ApbA F420_oxidored Sacchrp_dh_NADP UDPG_MGDP_dh_N NAD_Gly3P_dh_N NAD_binding_2 3HCDH_N DUF5376
Motif
Other DBs
NCBI-ProteinID: ASA22520
UniProt: A0A2Z2KH70
Position
complement(3980133..3981338)
Genome map
AA seq 401 aa AA seqDB search
MRAVHFGAGNIGRGFIGPMLSRSGYEVCFVGRNKNKMARLQERGQYKVTLANENRDSYMV
KNITAIDLNNAEQVAEAIADAQIVTTAVGISALKDIAGAIAQGIELRLSRNAESAPLHII
ACENGIASGQQLKRSVYRHMSASLVEEANRKIAFPNVMVDRIVPVQKNKESFEILVEPFS
EWVIPRGGMIGEYPEIKGVHYVEALEPYLERKLFTLNTGHCSAAYFGYLEGYTTIQEAMS
DPVIESHVRGVLEETGALLAHRHGFDSEVHSRYIEKTIQRFNNSNFSDKITRVARSPLRK
LAPKDRLVQPALQACELGLETNHLVSAITSALFFDHPGDPEALDLQRAIRDTGLSGIITA
IMGIPIEHPLHRRIIIEYNNICMKYPPMASTGFEAMVRTIG
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
ttgagagccgtacattttggtgctggcaatattggccgtggattcattggcccgatgttg
tcacgctccggttatgaggtatgttttgtaggcagaaataagaataaaatggcccgtcta
caggaacgggggcaatataaggtgacactggccaatgagaaccgagacagctacatggtc
aagaatatcaccgccatcgatttgaataatgcagagcaggtggccgaggccattgcggat
gcgcaaatcgtaacgacagcggtgggaatatcggccttgaaggacattgcaggtgcgatt
gcccaagggattgagctgcggctcagccggaatgccgagtcagccccactgcacattatt
gcctgtgagaatggaatagcgagcggccaacagttaaaaagatcagtctaccgccacatg
agcgcctcgctggtggaagaagcgaaccggaagatcgcttttccgaatgtgatggtcgac
cggatcgtacctgtgcagaagaacaaagagtcgttcgaaatcctcgttgaacccttcagt
gagtgggtgattccccgcgggggcatgattggcgagtacccggaaatcaagggggtgcat
tacgtggaggctctggaaccttatctggagcgtaagctgttcaccttaaataccggacat
tgcagcgcagcctatttcggctacctggaaggatacactacgattcaggaggcgatgtca
gaccccgtcatagagtcgcatgtccgcggtgttctggaagagaccggagcgctgctggct
caccgccacggcttcgattccgaggttcactcccgctatatcgagaaaaccatccaacgc
ttcaacaactctaactttagcgataaaatcacacgcgtagcccgttccccgcttcgcaag
ctcgctcccaaagaccggcttgtacagcctgccctgcaggcctgtgagcttggcttggag
acgaatcatcttgtctcggcgataacatccgcgctgttcttcgatcaccctggtgatccg
gaagcgttagacctgcagcgcgcgattcgtgataccggactgtccggcataataaccgcc
ataatgggtatccccatcgaacatccgctgcaccgccgcattatcatcgagtacaacaac
atttgcatgaaataccctcctatggcaagcaccggtttcgaagccatggttcgcacgatc
ggttaa

DBGET integrated database retrieval system