KEGG   Paenibacillus donghaensis: B9T62_37915Help
Entry
B9T62_37915       CDS       T04971                                 

Definition
(GenBank) mismatch-specific DNA-glycosylase
  KO
K03649  double-stranded uracil-DNA glycosylase [EC:3.2.2.28]
Organism
pdh  Paenibacillus donghaensis
Pathway
pdh03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:pdh00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    B9T62_37915
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pdh03400]
    B9T62_37915
Enzymes [BR:pdh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.28  double-stranded uracil-DNA glycosylase
     B9T62_37915
DNA repair and recombination proteins [BR:pdh03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     B9T62_37915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: ASA25983
UniProt: A0A2Z2KQA6
Position
8386148..8386675
Genome map
AA seq 175 aa AA seqDB search
MEEVPDHLDHGLQIVFVGFNPSLLSGELGHHYANLRNNFWRILHQSGLTPRLYEAAEDGE
LLKLGYGFTNIVSRPTRGAEDITREEYNEGRELLRGKLEQYRPEITCFVGKGVYTEFSRR
KQADWGFQESSDPVVDGVKEFVAPSSSGLVRMPMPRIVGIYRELSDYIREHMPLS
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggaggaagtgccggatcatctggatcacggactgcagatcgtatttgtcggcttcaat
cccagcttgctctccggcgagctgggacatcattacgctaacctgcgcaacaacttctgg
agaattctgcaccaatcagggctgacgccgcgattgtatgaggctgcagaggatggcgag
ttgttgaagctgggctatggcttcacgaatatcgtctcccggccgacgcggggggcggag
gatattacacgtgaggagtataatgagggacgtgaactgctccgtgggaagctggagcaa
taccgcccggagatcacttgcttcgtgggcaaaggcgtgtataccgaattcagccgcagg
aagcaggcggattgggggtttcaggagtcttccgatccggtggtggatggggttaaagag
ttcgtcgcaccgtcctccagcgggctggtgcggatgccgatgccgcgcatcgtggggatt
taccgcgagctgtctgattatatccgggagcatatgccgctgtcctga

DBGET integrated database retrieval system