KEGG   Parabacteroides distasonis: BDI_0665Help
Entry
BDI_0665          CDS       T00549                                 

Definition
(GenBank) glycoside hydrolase family 20, candidate beta-N-acetylhexosaminidase
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
pdi  Parabacteroides distasonis
Pathway
pdi00511  Other glycan degradation
pdi00520  Amino sugar and nucleotide sugar metabolism
pdi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BDI_0665
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BDI_0665
Enzymes [BR:pdi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BDI_0665
Chaperones and folding catalysts [BR:pdi03110]
 Intramolecular chaperones
  Others
   BDI_0665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 Glyco_hydro_20b Fn3_assoc CHB_HEX_C_1 F5_F8_type_C Glycohydro_20b2 CHB_HEX_C
Motif
Other DBs
NCBI-ProteinID: ABR42441
UniProt: A6L9S7
Position
788928..791105
Genome map
AA seq 725 aa AA seqDB search
MTLPKRSCMKVTGLALACSSLLFSCAPKEVPQVNLIPKPAHIEVTGGYFKVDSNLIFGND
QSGTIRYVVDESFNGGNPEGYALDVTEKGIELRAASKSGLFYGEQTLRQLYTSKGIPCVS
IQDNPRFPYRGLHLDVSRHFFPKEEVMKLLNVMSYYKLNTLHMHLTDAGGWRIQMDKYPK
LTTDVAFRTESDWQKWWDGKDRKYLPEGTPGAYGGYFTKEDIREIVDYATARHINIIPEI
EFPGHSDEVFVAYPELSCAGKPYTTGDFCIGNEKSFTFMEDVLSEVIELFPSEYIHIGGD
EAGKGAWKTCPKCQGLMRRNGMKDVDELQSYMIHRAEEFLISKGRKLIGWDEILEGGLAP
EATVMSWRGEEGGIKSARMGHNVVMTPGGYMYFDFYQADPKTQPYAIGGYTPIKRAYSYN
PVPMDSLTAEESKHILGVQANTWTEYIKDEKHLEYMMFPRALAVAEIGWTPQEDRSWEDF
KPRMNANIPVLQRMGIHTFTLSDEIETTMEVDTLRREIKVMLDAEKYPAEIRYTTDGSIP
TASSRVYNGPIVVKDSADIKAAIFRDGQLQGTPTEKKVDYHRGINKPIHYNSKLYSGYMA
GGMNALLDGYRGGLTYLDGRWQGYLNDLDCVVDMGEVTDIHKVSSRFMQLIGPGVYQPGE
VELLTSEDGESYISQGVIPTTISNTDKDLSFQEYTFNGDWKARYIRIKAKEANKGFIFTD
EIVIW
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgacgttgccaaaacggtcttgcatgaaagtaaccggacttgctctcgcttgttcctca
ctacttttttcctgtgctcccaaggaggttccgcaggtgaatttaatccctaagccggcc
catatcgaggtgactggcggttatttcaaagtagatagtaatctcatattcgggaatgat
caatcgggtacgatccgttacgtggtcgatgagtcttttaatggcgggaatccggaagga
tatgcgttggacgtgaccgagaaggggattgagttgagagccgcctctaaatccggattg
ttttacggggaacaaacgttgcgccagctgtatacgtcgaaagggattccttgcgtatcg
atccaagataatccccgtttcccgtatcgtggcttgcatctggatgtctcccgtcatttc
ttcccgaaagaggaggtgatgaagttattgaacgtcatgtcttattataaattgaatacg
cttcatatgcatttgacggatgccggtggttggcgtatccagatggataaatacccgaaa
ctgactacggacgtggctttccgtacggaatccgattggcagaaatggtgggatggaaag
gatcgcaagtatctgccggaaggaactccgggggcatatggcggttattttacgaaagaa
gatatccgtgagatcgtggattacgctacggcccggcatattaatataataccggaaatc
gaattcccggggcattcggacgaggtgttcgtggcgtacccggagttgagttgtgccggc
aaaccttatacgacgggtgatttctgcatcggcaacgagaaatcgtttacgttcatggag
gatgtattgtccgaggtgatcgagttgttcccttccgaatatatccatatcgggggagac
gaggccgggaagggagcttggaagacctgcccgaaatgtcaaggcttgatgcgccggaac
gggatgaaggacgtggatgagttgcagagctatatgattcatcgtgccgaggaattcctg
atttccaaaggccgcaaattgatcggttgggatgagattctggaagggggcttggctccg
gaggctaccgtcatgtcttggcggggtgaggaagggggaatcaagtccgctcgcatggga
cacaacgtggtcatgacaccgggtggttatatgtatttcgatttctatcaagccgatccg
aagacacagccgtatgccatcggcggttatacgccgattaagcgggcgtacagttataat
ccggtgcctatggattcgttgactgccgaggaaagtaagcatatcctaggggtacaggcg
aatacatggacggagtatatcaaggatgagaagcatctggagtatatgatgttccctcgt
gccttggcggtcgccgagattggatggactccgcaagaggatcgtagttgggaggatttt
aagcctcgtatgaacgctaatatcccggttctgcaacggatgggtatccatacgttcacg
ctctcggacgagattgagaccacgatggaggtagataccttgcggcgagagatcaaggtc
atgttggatgcggagaaatatccggcggagatacgttacacgacagacggctctattccc
accgcctcttcccgggtctataacggcccgatcgtggtgaaagactccgctgatatcaag
gccgctatcttccgtgacgggcagcttcaaggaacgcctaccgagaagaaggtggattat
caccggggtatcaataagcctatacattataatagtaagctgtatagcggttatatggcg
ggtggcatgaacgccttgctggacggttacaggggaggcttgacttatctggacggtcgt
tggcagggttatttgaatgacttggattgcgtggtggacatgggcgaggtgacggatatc
cataaggtatcgtcccgctttatgcaattgatcggcccgggcgtgtaccaaccgggagag
gtggagttgctgacatcggaagacggggagagctatatctcgcagggagttatccctact
acgatatccaatacggataaagacctgtcttttcaggaatacacgtttaacggcgattgg
aaagcccgttatatccgtatcaaggcaaaagaggcgaataagggtttcatcttcacggat
gagatcgtgatctggtaa

DBGET integrated database retrieval system