KEGG   Parabacteroides distasonis: BDI_0792Help
Entry
BDI_0792          CDS       T00549                                 

Definition
(GenBank) sulfite synthesis pathway protein CysQ
  KO
K01082  3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
pdi  Parabacteroides distasonis
Pathway
pdi00920  Sulfur metabolism
pdi01100  Metabolic pathways
pdi01120  Microbial metabolism in diverse environments
pdi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pdi00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    BDI_0792
Enzymes [BR:pdi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     BDI_0792
Transfer RNA biogenesis [BR:pdi03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    BDI_0792
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Inositol_P
Motif
Other DBs
NCBI-ProteinID: ABR42562
UniProt: A6LA48
Position
932186..932995
Genome map
AA seq 269 aa AA seqDB search
MMSYANYLYIAIHAAVDAGKSIMDIYNDPESDFGIERKADNSPLTKADKAAHRLITNALS
VTPFPVLSEEGKEIPFKERSKWETLWIVDPLDGTKEFIKKNGEFTVNIALVEKGVPVLGV
IYVPVRKELYFASSSVGAYKFTGIDSSSQPSMDEMKQRAIHLPIALAHQGVVVVASRSHQ
TEETTAFIDNLRKQGKPVTLISSGSSLKICLVAEGSADIYPRFAPTMEWDTAAGHAIAKS
AGCDIYHIDGKTPLRYNKEDLHNPWFIVK
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgatgagctacgccaattatctttacattgcgatccatgccgcggtagacgcaggcaag
tcgatcatggatatttataacgaccccgaatcagacttcgggatagagagaaaagcagac
aactcgccgttgacaaaggcggataaggcggcccatcgattgataacaaacgctttgtcc
gttaccccgtttccggtcttaagcgaggaaggaaaggagatcccgttcaaggagcgctcc
aaatgggagacgctgtggatcgtggacccgctggacggtaccaaggagtttatcaagaaa
aacggcgagtttaccgtgaatatcgccttggtggagaagggtgtgcccgtgttgggcgtc
atttatgtgcccgtccggaaggagttgtatttcgcctcctcctctgtgggtgcttataag
tttacgggaatcgatagcagtagccagccctcgatggacgagatgaagcagcgggcgata
catttgccgatagcgctggcgcatcaaggagtcgtggtagtggcgtcccggtctcaccaa
acggaggagaccaccgctttcatcgataatctccgcaagcagggaaagcccgttacgttg
atcagtagcggcagcagcctgaagatttgtctggtagcggaaggctcggccgatatctat
ccccgtttcgccccgacgatggagtgggataccgccgccggccacgccatcgccaagtct
gccggttgcgacatatatcatatcgacggcaagaccccgcttcgctataacaaggaagat
ttgcataatccgtggtttatcgtgaagtga

DBGET integrated database retrieval system