KEGG   Parabacteroides distasonis: BDI_1014Help
Entry
BDI_1014          CDS       T00549                                 

Definition
(GenBank) formate-tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
pdi  Parabacteroides distasonis
Pathway
pdi00670  One carbon pool by folate
pdi01100  Metabolic pathways
pdi01120  Microbial metabolism in diverse environments
pdi01200  Carbon metabolism
Module
pdi_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:pdi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    BDI_1014
Enzymes [BR:pdi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     BDI_1014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS AAA_31 ParA CbiA ArsA_ATPase AAA_26
Motif
Other DBs
NCBI-ProteinID: ABR42780
UniProt: A6LAR6
Position
complement(1173123..1174790)
Genome map
AA seq 555 aa AA seqDB search
MKSDIEIARETDLRKIKEVATTLGIPREEVQNYGRYIAKVPIHLIDKKQMDQHNLILVTA
ITPTKAGIGKTTVSIGLALGLNKIGKKAVVALREPSLGPCFGMKGGAAGGGYAQVLPMEN
INLHFTGDFHAVTSAHNMITALLDNYIYQTRNTCEGLKEIKWKRVLDVNDRSLRNIVSGL
GGSANGVPTETGFDITPASEIMAILCLATDIEDLKRRVGNILLGYTNEDKPFTVNDLGIA
GAITVLLKDALLPNLVQTTENTPAFVHGGPFANIAHGCNSISATQMALTYGDYVITEAGF
GADLGAEKFFNIKCRKAGLSPKLTVIVATAQSLKLHGGVPEKEIKEPNIEGLKNGFANLD
KHIENMKSFGQQVIVTFNRFATDTDEEIALVAEHCEEKGVGFAMNNVFAEGGEGGTELAR
LVVDTIENHPSAPLQYTYDLNDPIRTKVQKVAQKIYGASSIVYTTLADKKLRQIESLGIS
HYPICIAKTQYSFSSDPKAYGVAKDFELKVRDVIINNGAEMIVVVMGEIMRMPGLPKEPQ
ARKIDIVDGMIEGLS
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcggacattgagatagcaagagaaacagacttgcgtaaaattaaggaagttgcg
acaacgttaggtatccctcgtgaggaagtacaaaattatggcaggtatattgccaaggtt
cctatccatttgatcgataaaaagcaaatggaccagcataatttaattttagtgaccgct
atcactcccactaaagcgggaatcggaaagactacggtttcgatcggtctggctttaggg
ctgaataaaatagggaagaaagcggtggtcgctttacgtgagccgtctcttggcccgtgt
ttcggcatgaaaggtggtgctgccggaggtggatatgcccaagtgcttcccatggaaaac
atcaacttgcattttacaggggattttcatgcggttacttccgcccacaatatgattacc
gctttattggataactatatttatcagacccgcaacacctgcgagggattgaaggagatc
aaatggaaacgggttcttgacgtaaacgaccgtagcttacgtaacatcgtatcgggtcta
ggcggctcggcgaacggtgtccctaccgagaccggatttgacatcactcccgcttcagag
atcatggcgatcctttgcttggctacggatatagaggatttgaaacgacgtgtcggaaat
attttattgggttatacaaacgaagataagcctttcacggtaaatgatcttggcatagcc
ggagctattaccgtattgctaaaagacgcattactgccgaaccttgtacaaacaacggag
aatactcccgcatttgtacatggaggtcctttcgctaatatcgcccatggatgtaattcc
atatcggccacccaaatggctcttacttatggagattatgtgattacggaggctggtttc
ggcgctgatctgggcgcagagaaattctttaatatcaaatgtagaaaagcggggctttca
ccgaaactgacagtcatcgtagcgactgcccagagcttgaaacttcatggtggcgttccg
gagaaagaaatcaaggaaccgaatatcgaaggattaaagaacggattcgctaacttagat
aaacacattgagaatatgaagagcttcggccagcaagtaatcgttactttcaaccgtttc
gctaccgatacggacgaggagattgcgttagtggctgagcattgcgaggagaaaggggtt
ggattcgccatgaataacgttttcgccgaaggcggtgaagggggtacggagcttgcccgc
ttagtggttgatacgatcgaaaatcatccttccgctcctttacaatatacatatgatctg
aatgatccgatccgtacgaaggtacaaaaagtggcccagaagatatacggagcttcttcg
attgtttatacgactttggccgataaaaaattgcgtcagatcgaaagcttgggtatttcc
cattatccgatctgtatcgccaagactcaatattcattctcttccgatccgaaagcttat
ggggtcgccaaagatttcgaactaaaagtacgagatgtaatcatcaataacggagccgag
atgatcgttgtcgtcatgggcgagatcatgcgtatgccgggactcccgaaagagccgcaa
gcccgaaagatcgatatcgtggatggcatgattgagggattgagttaa

DBGET integrated database retrieval system