KEGG   Parabacteroides distasonis: BDI_1749Help
Entry
BDI_1749          CDS       T00549                                 

Definition
(GenBank) ROK family transcriptional repressor
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
pdi  Parabacteroides distasonis
Pathway
pdi00010  Glycolysis / Gluconeogenesis
pdi00052  Galactose metabolism
pdi00500  Starch and sucrose metabolism
pdi00520  Amino sugar and nucleotide sugar metabolism
pdi00521  Streptomycin biosynthesis
pdi00524  Neomycin, kanamycin and gentamicin biosynthesis
pdi01100  Metabolic pathways
pdi01110  Biosynthesis of secondary metabolites
pdi01120  Microbial metabolism in diverse environments
pdi01130  Biosynthesis of antibiotics
pdi01200  Carbon metabolism
Module
pdi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pdi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BDI_1749
   00052 Galactose metabolism
    BDI_1749
   00500 Starch and sucrose metabolism
    BDI_1749
   00520 Amino sugar and nucleotide sugar metabolism
    BDI_1749
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BDI_1749
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    BDI_1749
Enzymes [BR:pdi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BDI_1749
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ABR43496
UniProt: A6LCT2
Position
complement(2074373..2075230)
Genome map
AA seq 285 aa AA seqDB search
MSVEKKNAYIGVDLGGTNMRAGRIVGDRLVAQGSAPTPKDAADCEETLEALIEVIRSVWD
ESVVAIGIGVPSVVDREKGIVYNVVNIPHWEEVHLKEILEACFSVPVYVDNDANCFALGE
RIFGEGKTVDNFVGLTLGTGLGGGIIQNGKLLADANCGSGEFGMIPYQGHILEYFCSGSY
FMNVWGVDGKEMYTRAMRKDEQALEAYRQLGVHVAAAIKIVVLTVDPEMIVFGGSVTAAH
ELFEESMYEDLKDFAYPNSIKNLKIRFSKLENPGLFGAASLCYDK
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtagagaagaaaaacgcttatatcggagtggatttaggggggacgaatatgcgt
gccggccgtatcgtaggggatcgattagtggctcaggggagcgccccgactcccaaggac
gccgcggattgcgaggagacattggaggctttgatagaggtgatccgttccgtgtgggac
gagagtgtggtagctatcggtatcggtgtgccgagcgtggtggatcgtgagaaggggatc
gtatataacgtggtgaatatcccgcattgggaggaggtacatttgaaggagatattggag
gcttgcttctccgtgccggtttatgtggataacgacgcgaattgcttcgctctgggtgag
cgtatctttggcgaaggaaagacggttgataacttcgtgggtctcaccttgggtacgggc
ttggggggtggaattatccagaatggcaagctgttggccgacgctaattgtggctcggga
gaatttggcatgattccctaccaaggtcatatcttggaatatttctgtagcggttcctat
ttcatgaacgtatggggcgtggatgggaaggagatgtacacccgtgcgatgcggaaggac
gagcaggcgctggaggcttaccggcagttgggcgtacatgtggccgccgctatcaagatc
gtggtattgacggtagatccggagatgatcgtcttcggaggctcggtgaccgccgcccat
gagttgtttgaggagagcatgtatgaggacttgaaggatttcgcttatccgaactctatc
aagaacttgaagatacgtttctctaagctggagaatccggggctattcggtgccgcttcc
ctttgttatgataaataa

DBGET integrated database retrieval system