KEGG   Parabacteroides distasonis: BDI_1757Help
Entry
BDI_1757          CDS       T00549                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
pdi  Parabacteroides distasonis
Pathway
pdi00220  Arginine biosynthesis
pdi00330  Arginine and proline metabolism
pdi01100  Metabolic pathways
pdi01110  Biosynthesis of secondary metabolites
pdi01130  Biosynthesis of antibiotics
pdi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pdi00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    BDI_1757
   00330 Arginine and proline metabolism
    BDI_1757
Enzymes [BR:pdi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     BDI_1757
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ABR43504
UniProt: A6LCU0
Position
2086378..2087250
Genome map
AA seq 290 aa AA seqDB search
MEDKTSTLRLIYPQWQGGIVNHWMPDLPADDASRGYYLGAQLLNILAPPSPQKTVEVPIS
LDINDRETDLGISARKVILKQTKAALELLHENAPEKIITLGGECSVSVVPFTYLAAKYPD
DIAIVWIDAHPDINLPYDEYKGYHAMALTACLGMGDEEILQLLPGMFKVSNTLIVGLRSW
DEGMKERQKNLGIKGLSPEEVAKDSSSILKWLKGTGASKVVVHFDMDVIDPADMIAGVGV
EPNGMKIDEVVRVINNIASKYDLVGLTVAEPMPRIAIKLRNMLDRLPLLK
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggaagataaaacatcgacacttcgtttgatctatccccaatggcaaggtgggatcgtg
aatcattggatgcccgaccttcctgcggacgacgcttccagagggtattacctaggagct
caattactcaatatcctcgctcccccaagtccccagaaaaccgtggaagtacccatctca
ctagatataaacgatagagaaacggatctagggatcagcgcccgcaaggttattctgaaa
caaacaaaagcagccctcgaattactgcacgaaaacgctccagaaaagattatcacctta
gggggcgaatgttcggtaagtgtcgtacccttcacctatctggctgctaaatatccggat
gatatagccattgtctggatagacgcacatccggatataaacttgccgtatgacgagtat
aagggatatcatgcgatggcccttacggcctgtctagggatgggtgatgaagagattctt
caattattaccgggaatgttcaaggtctcgaataccttaatcgtaggtttacgctcgtgg
gatgagggcatgaaagaacggcagaagaacttaggtataaaaggtttatcaccagaggag
gtggcgaaggatagttcctccatcctcaagtggttaaaagggacgggcgcatccaaagtt
gtcgttcacttcgatatggacgtaatcgatccggcggatatgatagcgggagtcggcgta
gagcctaacgggatgaaaatagacgaggtcgtacgtgttatcaacaatatagcatccaag
tatgatctggtaggtcttacggtagccgagccgatgcctcgtatagccatcaagctaagg
aatatgctggaccggttacctttattgaaataa

DBGET integrated database retrieval system