KEGG   Parabacteroides distasonis: BDI_2087Help
Entry
BDI_2087          CDS       T00549                                 

Definition
(GenBank) aldehyde dehydrogenase A
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
pdi  Parabacteroides distasonis
Pathway
pdi00620  Pyruvate metabolism
pdi00630  Glyoxylate and dicarboxylate metabolism
pdi01100  Metabolic pathways
pdi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pdi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BDI_2087
   00630 Glyoxylate and dicarboxylate metabolism
    BDI_2087
Enzymes [BR:pdi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     BDI_2087
    1.2.1.22  lactaldehyde dehydrogenase
     BDI_2087
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ABR43818
UniProt: A6LDQ4
Position
2468894..2470330
Genome map
AA seq 478 aa AA seqDB search
MKELKMFIDGRFIDNESGKWIKVLNPSTEEVISLMPDGTVEDARKAIDAAEKAQNQWERT
PSIERAAYLTKIAAGIRKREKELTDIIVREGGKTQGLANVEVLFTADYMDYMAGWARRYE
GEIIPSDRPHENIFLFKRPIGVTTGILPWNFPFFLVARKAAPALITGNTIVIKPSQLTPE
NAYVFAQIVEEAGLPAGVFNLVNGRGSVIGHELSANPKVGMVSLTGSVGAGQQTMAAAAP
NITKVSLELGGKAPAIVMKDADVDLAVKSIIASRVINTGQVCNCAERVYVDKAIKETFME
KLVAGMKQVKVGNPNEIADLDMGPLIEASALKSMEKKVERAIQQGARLLCGGHRIGTKGY
FFEPTVLDCVTQKMDIIQEETFGPVLPVVEYSDINDAIAWANDCEYGLTSSVYTQNLDNA
FKVMRSLKFGETYINRENFEAMQGFHAGWRKSGIGGADGKHGLEEYLQTQVVYLETKE
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaattgaaaatgtttatagatggcagattcattgataatgagtctgggaaatgg
atcaaggtattgaatccttctaccgaagaggttatttcactgatgcccgacgggacggtt
gaagatgccagaaaagcgatcgatgccgcagagaaagcgcagaatcaatgggaaagaacg
ccctccatagaaagggctgcttatctgacaaagatagcggctggcatccgtaagagagag
aaggaactgaccgacatcatcgtccgtgaaggaggcaaaacccaaggactcgccaatgtt
gaagtcctttttaccgcggactatatggattacatggcaggctgggcccgccggtacgaa
ggggaaatcattcccagtgaccgccctcatgaaaacattttcttatttaagagaccgatt
ggagtaacgacaggtatcctaccttggaatttcccattctttctagtcgctcgtaaagcc
gcgccggccttgatcaccggaaatacgatcgtaataaaacctagccagcttacgccagag
aacgcatatgtattcgcgcagatcgtggaggaggcaggtttgcctgccggcgttttcaat
ctagtaaatggacggggtagcgtgattggtcatgaactctcggcgaatccgaaagtaggc
atggtaagtctgacaggaagcgtgggagccggacaacagaccatggcagccgccgctcct
aatatcacgaaagtttctctggagttaggaggtaaagccccggctatcgtgatgaaggac
gcagatgtcgatctcgccgttaaatccattattgcctctcgtgtgatcaataccggacag
gtatgtaattgtgccgaacgggtttatgtagacaaagcgataaaagagaccttcatggaa
aaactagtcgccggcatgaagcaggtaaaagtaggaaaccccaatgagatcgcggatctg
gatatgggacctcttatcgaagccagtgcgttgaagtctatggagaaaaaagtagaaaga
gcgatccagcaaggtgctaggctactgtgtggtggtcataggatcggtacaaaaggatat
ttcttcgaaccgaccgttttggattgtgttacgcagaaaatggatatcatacaagaagag
acttttggccccgtgctaccggttgtcgaatattcggacatcaacgacgctatcgcatgg
gcgaatgattgcgaatatggattgacatcttccgtatatacacaaaacttggataacgca
ttcaaggtaatgcgttccttaaaattcggggagacttatattaaccgtgagaattttgag
gctatgcaaggcttccatgcgggatggcgcaaatccggaatcggtggtgcggacggaaaa
catggacttgaggagtatttgcaaactcaagtggtttatcttgagacaaaggaataa

DBGET integrated database retrieval system