KEGG   Parabacteroides distasonis: BDI_2629Help
Entry
BDI_2629          CDS       T00549                                 

Definition
(GenBank) conserved hypothetical protein
Organism
pdi  Parabacteroides distasonis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ABR44348
UniProt: A6LF84
Position
complement(3107562..3108257)
Genome map
AA seq 231 aa AA seqDB search
MEKCRKLVIVRHGNTFRAGETPTRVGARTDLPLVEEERARSAGRYLREKGIVIDKVISAP
LKRTLETANYILEEMNVDLPIIQDLRLKEIDYGPDENMVEDHVIKRLGSLYLEKEGMDRK
DLTEDRIVESGLSVIAQWNEKAVVPLGWNVDVEKLISGWQDLAASIPDGETWLLVSSNGV
MRFSPYILGNYEDFCATHDIKVPTGGVCIFDCVGDHWRCTDWGIKAYKLFK
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaatgtagaaaacttgtgatcgtacggcatggtaatacgtttcgtgcgggagag
actccgactcgggttggagctagaactgatttgcctctggtagaggaggaacgagctaga
tctgcgggacgttatttacgtgaaaaggggattgtgatcgacaaggtgatttcggccccc
ttaaaacgcacattggagaccgctaactatatcttggaggaaatgaatgtggatttgcct
atcattcaagacttacgtcttaaagagattgattatgggccggatgagaatatggtagaa
gatcatgtaataaaacgtttgggatctctctatttagaaaaggagggaatggaccggaaa
gacctaacggaagatcggatcgtggagagtggactttccgtgatcgcccaatggaatgag
aaggccgtggtaccgttaggatggaacgtagatgtagagaaactgataagcggttggcag
gatttggcggctagtatacctgatggtgagacttggctgctagtatcttccaatggagtg
atgcgtttctccccctatattctggggaattatgaggatttctgtgcgactcatgatatt
aaggttccgacaggtggggtttgtatattcgattgtgtgggtgatcattggaggtgtacg
gattggggaataaaggcttataaactttttaaatga

DBGET integrated database retrieval system