KEGG   Parabacteroides distasonis: BDI_3152Help
Entry
BDI_3152          CDS       T00549                                 

Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
pdi  Parabacteroides distasonis
Pathway
pdi00520  Amino sugar and nucleotide sugar metabolism
pdi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BDI_3152
Enzymes [BR:pdi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     BDI_3152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3 HU-DNA_bdg
Motif
Other DBs
NCBI-ProteinID: ABR44858
UniProt: A6LGP4
Position
complement(3810664..3811839)
Genome map
AA seq 391 aa AA seqDB search
MESAFLKIINAKVLTPSGLLPNGQIIISDGKIVEITGQNREIPHAEIIDAKGYYVAPGCI
DTHVHGGNGHDFTEATPKAFYAITRAHALQGTTALYPTLAAAPIDTFREAIKTCEHIMNH
PEQGARIMGLHLEGNYLNMAMKGGQDPNYIYPPDPQEYKELLNSTQCVKRWSAAPELDGA
LEFGKYASAHGVLVSLAHTTADYLQVKKAYEAGFTHATHFYNAMTSVHKDREYKHEGTVE
GIYLMKDMTVEVVADGIHVPPAILKLVYQIKGVERTSLITDAMAAAACDNGTEHFPDSRV
IIEEGVCKLADRSAIAGSIATGIRLIRTLVEKAEIPLHDAVRMASESPARLMGLLDRKGT
LEKGKDADIIIFNNDIEIQETFIEGKRLSKE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcgcatttcttaaaatcataaacgcaaaagtattaactccttcgggtctccta
ccaaacgggcaaatcatcatctcggatgggaaaatagtggagatcaccgggcaaaaccgg
gagattcctcatgcggagatcatcgacgcaaaaggatattatgtggctcccggctgtatc
gacacgcatgtacacggcggcaacggacatgatttcacggaagctaccccgaaagcgttc
tatgcgatcacaagagcacatgctttacagggaacaacggctttatatcctacattggca
gctgcccctatcgataccttccgggaagcgatcaagacctgcgagcacatcatgaaccac
ccggaacagggagcccgcatcatgggattacatctcgaaggcaactatttgaatatggct
atgaaaggcggacaagaccctaattatatttacccgcccgatccccaagaatataaggaa
ttactaaacagtacccaatgtgttaaacgctggagcgccgcccccgagcttgacggggct
ttggaattcggtaaatatgcgtcagctcatggtgtgttggtttcactagcccacaccaca
gccgattatctccaagtgaaaaaagcatacgaagccggattcacccatgctacccacttc
tacaatgccatgacttccgtccataaagaccgtgagtataaacatgaaggaacggtagaa
ggtatttatctcatgaaagatatgaccgttgaagttgtagccgatggtatccacgtaccg
ccggcaatcttaaagttggtatatcaaatcaaaggggtagaacgtacgtccttaatcacg
gacgcaatggccgccgccgcttgcgataacggtacggaacattttccggactcccgggta
attatcgaggaaggcgtatgtaaattagccgatcgctcagctatcgcgggaagtatagct
accggaatccgtttgatccgtaccctagtcgagaaagcggaaattccattgcacgacgct
gttcgtatggcttccgaaagcccagcccgcctaatgggtcttttagaccgtaaaggaaca
ttggagaaaggaaaggatgccgatatcatcattttcaacaacgatatagagattcaagag
accttcatcgaaggtaaacggctctccaaagaataa

DBGET integrated database retrieval system