KEGG   Pseudoalteromonas donghaensis: D0907_01990Help
Entry
D0907_01990       CDS       T05890                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
pdj  Pseudoalteromonas donghaensis
Pathway
pdj00730  Thiamine metabolism
pdj00790  Folate biosynthesis
pdj01100  Metabolic pathways
pdj02020  Two-component system
Module
pdj_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pdj00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    D0907_01990
   00790 Folate biosynthesis
    D0907_01990
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    D0907_01990
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pdj04147]
    D0907_01990
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pdj00537]
    D0907_01990
Enzymes [BR:pdj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     D0907_01990
Exosome [BR:pdj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   D0907_01990
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pdj00537]
 Enzymes
  D0907_01990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-ProteinID: AXV64129
Position
429492..431291
Genome map
AA seq 599 aa AA seqDB search
MKKLNLISLAVVVALAGCSDDDDKGPIETITVENTLAVGSEQCVNGGTETVLGEDTNRNG
ELDSAEIIETTVACNDPATSLTAQQLAPLTSNDWFKAAKVKMAASEDSIAAVAKESGKAK
NVILFVGDGMGISTVTAARIMAGQLEGKLGEEHQLSFEAMPFSGFAKTYNVDAQTPDSAG
TMTAMASGVKTDAGVIGVDEDIERGNCATVAGNELVTATELAEMAGKSTGIVSTARITHA
TPAATYAKSADRNWEDVSDMPEAAVAAGCEDIASQLVNFEANLEARYAGLDVDGLEVVLG
GGRRHFLPKDAAFNSADAVSSVEGDRTDGRDLTAEWKAKYPAGQYVMDQASFNAVNADTT
ERLFGLFNESHMQYEADRANDIAGEPSLSEMTAKAIDVLDNNDKGFFLTVEAGRIDHAHH
AGNAYNALSDTVELSKAVQVALDKTSIEDTLIIVTADHSHVFTIAGYPKRGNPILGKVVP
VGSDEPSLAADNMPYTTVGYTNGGGFRDLGDETDADAGYNFAPVTGRVDLTDVDTTTPGF
HQEAVVPLSSETHAAEDVGVYAVGPGAHLVTGTNEQSLIFHVMDYAADLVKQADAKLAQ
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactaaatttaatttctcttgctgtagtagtggcattagcgggttgttctgat
gatgatgacaaaggcccaattgaaacaatcacagttgaaaacaccttagctgtcgggtct
gagcagtgtgtaaatggtggtacagaaaccgtattgggtgaagatacaaaccgcaatggt
gagctagactcagcagaaatcatagagacaacggttgcgtgtaatgacccagccacatca
ctgaccgcacagcagcttgcgccactgacgagcaatgattggtttaaggccgcaaaagtt
aagatggcggcaagcgaagacagcatcgctgcggttgctaaagagtcagggaaagcgaaa
aacgtcattctatttgtgggtgatggtatggggatttctaccgtgacagcggcacgcatt
atggcgggtcagcttgaaggcaagctgggcgaagagcatcaactgagttttgaagcgatg
ccgttttctggttttgcaaaaacatacaacgttgacgcacaaacgccggattctgcgggt
acgatgacagcaatggcatctggtgttaaaacagatgcaggtgttatcggcgttgatgaa
gatatcgaacgtggtaactgtgcgacggttgcgggtaatgagctggtaacagcaacagag
cttgctgaaatggcaggcaaatcgaccgggattgtatcaacagcgcgaatcacacacgcc
acacctgccgccacctatgcaaaatcggctgaccgtaactgggaagatgtatctgatatg
ccagaagcggctgtcgctgcgggatgtgaagatatcgcctcgcaactcgttaacttcgaa
gcaaaccttgaagcacgttatgcgggattagatgttgatggcttagaagtcgtgttgggc
ggtggtcgtcgtcacttcttacctaaagatgccgcgtttaactctgcggacgctgtaagc
agtgttgaaggtgaccgtacggatggtcgcgacctaactgctgagtggaaagcgaaatac
ccagcgggtcaatatgttatggaccaagcaagttttaatgctgtgaatgcagacacaact
gagcgtttatttggtttattcaatgaatcacatatgcagtatgaagccgatcgcgctaac
gatattgctggtgagccttcattatctgaaatgaccgcaaaagcaattgacgtgcttgat
aacaatgacaaaggtttcttcttaaccgttgaagcgggtcgtattgaccatgctcaccat
gcgggcaatgcgtacaacgcattaagtgatacggttgagctttcaaaggctgttcaagtt
gcattggataaaaccagcattgaagatactttgatcattgttacggctgaccacagccat
gtgttcacgattgctggttatccaaaacgtggtaacccaattttaggtaaagtcgtgcct
gtggggagtgatgagccatcactcgcagcggataatatgccatacactaccgtaggatac
actaatggcggtggctttcgtgacttaggtgatgaaaccgatgcggatgctggctataac
tttgcacccgtgactgggcgtgttgatctcaccgatgttgatacaaccacaccgggtttc
catcaagaagcggtggtaccgcttagctctgaaacacacgcagcagaagatgtcggtgtg
tatgcagtaggcccaggagcccatttagttactggtacgaatgagcaaagccttattttc
catgtgatggattatgcggctgaccttgtgaaacaagctgatgctaaattagcccaataa

DBGET integrated database retrieval system