KEGG   Pseudoalteromonas donghaensis: D0907_02775Help
Entry
D0907_02775       CDS       T05890                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pdj  Pseudoalteromonas donghaensis
Pathway
pdj00480  Glutathione metabolism
pdj00590  Arachidonic acid metabolism
pdj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    D0907_02775
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    D0907_02775
Enzymes [BR:pdj01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     D0907_02775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AXV64275
Position
complement(584210..584785)
Genome map
AA seq 191 aa AA seqDB search
MNKYALLLCASLMSTHLAAESPPSIQDPVAETQCDDFTNVTLRKLRSKESVNLCEFKGKP
LLIVNTASNCGFTPQFEGLEAIHKEYKDRGLVVLGFPSDDFFQEEDDEKDTAKVCYINYG
VTFTMFATSAVRGSDANPIFKHLNEATSSPNWNFYKYIVSADRKTVERFNSKTKPESKAM
RDAIEAQLAAK
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatatgctttgttactctgtgcaagccttatgtctactcatcttgcagcagaa
tctcccccgtcaattcaagacccagtcgcagaaactcaatgtgatgactttaccaatgta
acgctgcgtaaattacgctcaaaagaaagtgttaatctttgcgaatttaaaggtaagcca
ttgctcatagtgaataccgcaagtaactgtggatttacgccacagtttgagggtttagaa
gcaattcataaagaatacaaagaccgtggtctcgttgttcttggtttcccttctgatgac
tttttccaagaagaagatgacgaaaaagacaccgcaaaagtatgctacattaattacggt
gttacctttaccatgttcgctaccagcgcggtgcgtggtagtgacgcaaacccaattttt
aagcacctaaacgaagcaacaagttcacctaattggaacttttacaaatatattgtttcg
gcagaccgtaaaacggttgagcgttttaacagtaaaaccaaaccagaatcaaaagctatg
cgtgacgcgattgaagcgcagttagctgcaaaataa

DBGET integrated database retrieval system