KEGG   Pseudoalteromonas donghaensis: D0907_10365Help
Entry
D0907_10365       CDS       T05890                                 

Gene name
rlmM
Definition
(GenBank) 23S rRNA (cytidine(2498)-2'-O)-methyltransferase RlmM
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
pdj  Pseudoalteromonas donghaensis
Brite
KEGG Orthology (KO) [BR:pdj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:pdj03009]
    D0907_10365 (rlmM)
Enzymes [BR:pdj01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     D0907_10365 (rlmM)
Ribosome biogenesis [BR:pdj03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    D0907_10365 (rlmM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ MIT_C
Motif
Other DBs
NCBI-ProteinID: AXV65642
Position
complement(2284976..2286061)
Genome map
AA seq 361 aa AA seqDB search
MSSVVIYCRSGFESDAAAEITFQAAEQGFAGYVKTKPNTGIVVYECFDPSHGDEIIKKID
FKNMVFARQWFTGTLVDNMPLEDRVSAIVNATVDFPSCGDLRVETPDTNEGKELSKFCKK
ISTPLKKALEKRATVTRELADKKPVLHVLFLSNDTAYVGYSYTFNNSPFFMGIPRLRMPN
DAPSRSTLKLDEAFNVFIPPHEAEDRLQPGMRGVDLGACPGGWTYQLVRRGMFVSAIDNG
PMNDDLMETGQVKHFRVDGFKYRPEKRNIHWLVCDMVEKPAKVTNLMIDWAVNAYAKELI
FNLKLPMKKRFDSVYECLKMIKEELEKYGVSYELQAKHLYHDREEVTVHLNVTKVPQSLY
S
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagtgttgttatttattgtcgcagtgggtttgaaagcgacgctgccgctgaaatc
acttttcaggctgcggaacaagggtttgcgggctatgtaaaaacgaagccgaacactgga
attgtcgtctatgaatgttttgatccgagccatggcgatgaaatcataaaaaaaatagat
ttcaaaaacatggtctttgcccgccaatggtttaccggtactttagtcgataatatgccg
cttgaagacagggtcagtgcgattgtgaatgcaaccgttgattttccatcctgtggtgac
ctacgagttgaaaccccagataccaatgaaggtaaagagttgtctaaattttgtaaaaag
atttcgacaccgctaaaaaaagccctcgaaaaacgcgcgacggttacgcgtgaacttgcg
gataaaaagcctgtgctgcatgtactctttttaagtaatgacactgcgtatgtagggtat
tcgtatacttttaataactcgccattttttatgggtatcccacgcctgcgtatgccaaat
gacgcaccaagccgttcaactcttaaacttgatgaagcgtttaatgtgtttattccgcct
catgaagccgaagaccgtttgcagccaggaatgcgaggcgttgatttaggggcgtgtccg
ggtggttggacataccaattggttcgtcgtggtatgtttgttagtgccatagataacggc
ccaatgaacgatgatttaatggaaaccggacaagtaaaacatttccgtgttgatggcttt
aaataccgtcctgaaaagcgaaatattcattggttagtatgtgatatggtggaaaagcca
gcaaaagttactaatcttatgattgattgggccgtgaatgcatacgcaaaagagcttatt
tttaatcttaaactgccaatgaaaaaacgcttcgacagtgtttatgaatgtttaaagatg
attaaggaagagcttgaaaaatacggcgttagttatgagcttcaggcaaaacatttatac
catgaccgtgaagaggttacggttcatttaaatgtcacaaaggtgccgcaaagcctatac
agttaa

DBGET integrated database retrieval system