KEGG   Pseudoalteromonas donghaensis: D0907_13610Help
Entry
D0907_13610       CDS       T05890                                 

Gene name
apaG
Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
pdj  Pseudoalteromonas donghaensis
Brite
KEGG Orthology (KO) [BR:pdj00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    D0907_13610 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: AXV66242
Position
3025971..3026360
Genome map
AA seq 129 aa AA seqDB search
MTTSSNLGSPIKVSVETFYVEGQSEPEQDKYVFAYSITIKNHSLCSAKLLSRYWLITDAN
GKEVEVQGEGVVGETPTIAPGESYKYTSGAVLDTPVGTMQGYYTMRNEFGTEFEAPIDVF
RLARPNILH
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaagcagtaatttaggttcgccaattaaggtctctgttgagaccttctacgtt
gaaggtcaatcggagcctgaacaagataaatacgtttttgcttactctatcacgattaaa
aatcatagtttgtgcagtgctaagctattaagtcgctactggttaattaccgatgccaat
ggcaaggaagtcgaagttcaaggcgaaggtgtcgttggtgaaacccccactattgcccca
ggtgaaagttataaatacaccagcggcgcagtgctcgacacccctgtagggacaatgcaa
ggttattacaccatgcgtaacgaattcggcactgaatttgaagccccgattgacgtgttt
cgtctagcacgccctaacatactgcattaa

DBGET integrated database retrieval system