KEGG   Pseudoalteromonas donghaensis: D0907_15055Help
Entry
D0907_15055       CDS       T05890                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
pdj  Pseudoalteromonas donghaensis
Brite
KEGG Orthology (KO) [BR:pdj00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    D0907_15055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AXV66514
Position
complement(3357795..3359063)
Genome map
AA seq 422 aa AA seqDB search
MDIIANYGTFLVLIAAAVGFFMAYGIGANDVANAMGTSVGSKALTIKQAIIIAMVFEFAG
AYLAGGEVTSTIRKGIIDATPFIDIPELMILGMIAALFAAGSWLLIASFLGWPVSTTHSI
IGAIIGFALVAVGSEAIQWNKVLGIVGSWIVTPAISGFIAYLIFMSAQKLIFDTDAPLKN
AKRFVPVYMGLAGFIMSLVTIKKGLKHIGINLGAVEGYALSIAIAVVVGIIGKFAISRLK
IDPKADKKMQFNNVEKVFAVLMVLTACCMAFAHGSNDVANAIGPLAAVVNIVEHNGEIAK
KAAIAWWILPLGGLGIVAGLAILGKKVIKTIGEGITHLTPSRGFAAELAAASTVVIASGT
GLPISTTQTLVGAVLGVGMARGIAALNMGVVRNIVVSWVITLPVGAALAIVIFYVLRTAF
GV
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggatatcattgcaaattacggcacttttttagttttaattgccgcagcagtcggtttc
ttcatggcttatggtattggtgcaaatgacgttgccaatgcgatgggtacatcagtaggt
tcaaaagcacttactatcaaacaagcaattattattgcgatggtgtttgaattcgcaggt
gcttaccttgccggtggtgaggttacatcaactattcgtaaaggaattatcgacgccacg
ccatttattgatatacctgagcttatgatcttaggcatgattgccgcgttatttgctgca
ggtagctggctattaatcgcctctttccttggctggcctgtatcgactactcactcaatt
atcggtgcgattattggttttgctttagtggctgttggcagcgaagcaatccaatggaat
aaagtactgggcattgtggggagttggattgtaacacctgcaatttcgggctttattgct
taccttatctttatgagtgcacaaaagcttatttttgataccgatgctccacttaaaaac
gctaagcgctttgtccctgtgtatatgggtctagcgggcttcattatgtctttagttacg
attaagaaaggcttgaagcacattggtattaacctaggcgctgttgagggttacgcactt
tctatcgcgatcgctgtcgtggttggtattattggtaagtttgctatttcacgcttaaaa
attgatcctaaagctgacaagaaaatgcaatttaataacgttgaaaaagtgttcgcggta
ttaatggtattaacagcttgttgtatggcattcgcccatggttcgaacgatgttgcaaac
gcgattggtccactagctgctgttgtaaacattgttgagcacaacggtgaaattgctaag
aaagccgctatcgcatggtggattttaccactgggtggtttgggtattgttgctggcctt
gctattttaggtaagaaagtaatcaaaacaatcggtgaaggtattactcatttaacgcct
agccgtggtttcgctgctgagcttgctgctgcatcaacggttgttattgcatcaggtacg
ggtttaccaatctctacaacacaaacgcttgtaggtgctgtattaggtgttggtatggca
cgtggtatcgcagcgcttaacatgggtgttgtaagaaacattgtagtttcttgggtaatt
acattgccagttggcgcagcccttgctattgttattttctacgtactgagaacagccttc
ggcgtttaa

DBGET integrated database retrieval system