KEGG   Pseudomonas aeruginosa DK2: PADK2_00400
Entry
PADK2_00400       CDS       T02161                                 

Definition
(GenBank) type VI secretion system protein ImpM
  KO
K11890  type VI secretion system protein ImpM
Organism
pdk  Pseudomonas aeruginosa DK2
Pathway
pdk02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:pdk00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PADK2_00400
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pdk02044]
    PADK2_00400
Secretion system [BR:pdk02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   PADK2_00400
SSDB
Motif
Pfam: TagF_N
Other DBs
NCBI-ProteinID: AFM62375
Structure
PDB: 
2QNU

Position
complement(89988..90668)
AA seq 226 aa
MNSVGFYGKLAGRGDFVSRGLPNTFVEPWDAWLASGMRASQDELGAAWLDAYLTSPLWRF
AIAPGLLGGEAVTGVVMPSIDRVGRYFPLTVACLLPANADLGGLVGGDDGWFEQVESLLL
STLEPEAEVEAFEQAVAQLPAPPCGPRIEQSLISGNLLRSEAVTPAQRLAALAQHACDGA
SHWWGRGSARISAGLMRYQGLPPAPAFGRFLTGEGEVIPLFPGIPG
NT seq 681 nt   +upstreamnt  +downstreamnt
ttgaacagcgtcggtttctacggcaagctggccggccgcggcgatttcgtcagccgcggc
ctgccgaacaccttcgtcgaaccctgggacgcctggctggccagcggcatgcgcgccagc
caggacgaactcggcgcggcctggctcgacgcctacctgaccagcccgctgtggcgcttc
gccatcgcccccggcctgctcggcggcgaagcggtgaccggagtggtgatgccgagcatc
gaccgggtcggtcgctatttcccgctgaccgtcgcctgcctgctaccggcgaacgccgac
ctcggcgggctggtcggcggcgacgacggctggttcgaacaggtcgagagcctgctgctc
tccaccctggaaccggaggccgaggtcgaggccttcgagcaggcggtggcgcagctcccg
gcaccgccctgcggaccgcgcatcgaacaatcgctgatcagcggcaacctgctgcgcagc
gaagcggtgaccccggcgcagcgcctcgccgcgctggcccagcacgcctgcgacggcgcc
agccactggtggggacgcggctcggcacggatctccgccggcctgatgcgctaccagggc
ctgccgccggcgccggcgttcggacgattcctcaccggagagggcgaggtgatcccgctc
tttcccggcatacccggttaa

DBGET integrated database retrieval system