KEGG   Pseudomonas aeruginosa DK2: PADK2_00420Help
Entry
PADK2_00420       CDS       T02161                                 

Definition
(GenBank) putative lipoprotein
  KO
K11906  type VI secretion system protein VasD
Organism
pdk  Pseudomonas aeruginosa DK2
Pathway
pdk03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pdk00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PADK2_00420
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pdk02044]
    PADK2_00420
Secretion system [BR:pdk02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PADK2_00420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS-SciN
Motif
Other DBs
NCBI-ProteinID: AFM62379
Structure
PDB: 

Position
complement(96898..97362)
Genome map
AA seq 154 aa AA seqDB search
MQKLIVALFGLLLAACSSSPPETPPTRVVIWLHAAPNLNPSAAGQAAPLRLRLYELKKDT
AFGRADYFALTDNAQSTLGGDLVEQDEFLLRPGEERRIERTLDEQTRQLGFVAAYRDLDR
ATWRQVLDVPGQRTSHLDITLGAQAIGIVARPAP
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaactgatcgtcgcgctgttcgggctgctgctcgccgcctgttcgtccagcccg
ccggaaaccccgccgacccgggtggtgatctggctccacgccgcaccgaacctcaacccg
tccgccgccggccaggcggcgccgctgcgcctgcggctgtacgagctgaagaaagacacc
gcgttcggccgcgccgactacttcgccctcaccgacaacgcccagtcgaccctcggtggc
gacctggtggagcaggacgagttcctcctgcgtccgggcgaggaacggcgcatcgaacgc
acgctcgacgagcagacccgccagctcggtttcgtcgccgcctaccgcgacctcgaccgc
gccacctggcgccaggtcctcgacgtgccggggcaacgcaccagccatctcgacatcacg
ctcggcgcgcaggccatcggcatcgtcgcgcgtcccgcgccctga

DBGET integrated database retrieval system