KEGG   Pseudomonas aeruginosa DK2: PADK2_00475
Entry
PADK2_00475       CDS       T02161                                 

Definition
(GenBank) hypothetical protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
pdk  Pseudomonas aeruginosa DK2
Pathway
pdk03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pdk00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PADK2_00475
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pdk02044]
    PADK2_00475
Secretion system [BR:pdk02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PADK2_00475
SSDB
Motif
Pfam: Phage_GPD Phage_base_V
Other DBs
NCBI-ProteinID: AFM62390
Structure
PDB: 
4UHV 6H3N 4MTK 6H3L

Position
110129..112048
AA seq 639 aa
MGLMQLTRLVQVDCPLGPDVLLLQRMEGREELGRLFAYELHLVSENPNLPLEQLLGKPMS
LSLELPGGSRRFFHGIVARCSQVAGHGQFAGYQATLRPWPWLLTRTSDCRIFQNQSVPEI
IKQVFRDLGFSDFEDALTRPYREWEYCVQYRETSFDFISRLMEQEGIYYWFRHEQKRHIL
VLSDAYGAHRSPGGYASVPYYPPTLGHRERDHFFDWQMAREVQPGSLTLNDYDFQRPGAR
LEVRSNIARPHAAADYPLYDYPGEYVQSQDGEQYARNRIEAIQAQHERVRLRGVVRGIGA
GHLFRLSGYPRDDQNREYLVVGAEYRVVQELYETGSGGAGSQFESELDCIDASQSFRLLP
QTPVPVVRGPQTAVVVGPKGEEIWTDQYGRVKVHFHWDRHDQSNENSSCWIRVSQAWAGK
NWGSMQIPRIGQEVIVSFLEGDPDRPIITGRVYNAEQTVPYELPANATQSGRVTPANFNE
IRMEDKKGAEQLYIHAERNQDNLVENDASLSVGHDRNKSIGHDELARIGNNRTRAVKLND
TLLVGGAKSDSVTGTYLIEAGAQIRLVCGKSVVEFNADGTINISGSAFNLYASGNGNIDT
GGRLDLNSGGASEVDAKGKGVQGTIDGQVQAMFPPPAKG
NT seq 1920 nt   +upstreamnt  +downstreamnt
atgggattgatgcaactgacccgcctggtccaggtggattgcccgctggggccggacgtg
ctgctgttgcagcgcatggagggacgcgaggaactgggacggctgttcgcctacgagctg
cacctggtatcggaaaatcccaacctgccgctggagcagttgctcggcaagccgatgagc
ctgtcgctggagctgcccggcggcagccggcgcttctttcacggcatcgtcgcgcgctgt
agccaggtggccgggcacggccagttcgccggctaccaggccaccctgcggccctggccg
tggctgctgacgcgcacctcggactgccgcatcttccagaaccagagcgtgccggagatc
atcaagcaggtgttccgcgacctcggcttttccgatttcgaggatgccctcacgcgcccc
taccgcgagtgggaatactgcgtgcagtaccgcgagaccagcttcgacttcatcagccgg
ctgatggaacaggagggcatctactactggttccgccatgagcagaagcgccacatcctg
gtgctctccgacgcctacggcgcgcatcgcagcccgggtggctacgccagcgtgccgtac
tacccgccgaccctcggccatcgcgagcgcgaccacttcttcgactggcagatggcacgc
gaggtccagcccggttcgctgaccctcaacgactacgacttccagcgccccggcgcgcgc
ctggaggtgcgttcgaacatcgcccggccgcacgcggcggccgactacccgctgtacgac
tatcccggcgaatacgtgcagagccaggacggcgagcagtacgcgcgcaaccgcatcgag
gcgatccaggcgcagcacgagcgcgtgcgcctgcgcggcgtggtgcgcgggatcggcgcc
gggcacctgttccgcctgagcggctatccgcgcgatgaccagaaccgcgagtacctggtg
gtcggcgccgaataccgggtggtccaggaactctacgaaaccggcagcggcggcgccggc
tcgcagttcgagagcgagctggactgcatcgacgccagccagtcgttccgtctcctgccg
cagactccggtaccggtggtgcggggtccgcagactgcggtggtggtcgggcccaagggc
gaggagatctggaccgaccagtacggccgggtcaaggtgcacttccactgggatcgccac
gaccagtcgaacgagaacagctcctgctggattcgcgtgtcccaggcctgggccgggaag
aactggggttcgatgcagatcccgcggatcggccaggaagtgatcgtcagcttcctcgaa
ggcgacccggaccggccgatcatcaccgggcgggtctacaacgccgagcagacggtgccc
tacgagctgccggcgaacgccacccagagcgggagagtgacgccggccaacttcaacgag
atccgcatggaggacaagaagggcgccgagcagttatacatccacgccgagcgcaaccag
gacaacctggtcgagaacgatgcctcgctgtcggtcggccacgaccgcaacaagagcatc
ggccacgacgagctggcgcgcatcggcaacaaccgcacccgcgcggtgaagctcaacgac
accctgttggtgggcggggcgaagagcgacagcgtcaccggcacctacctgatcgaggcc
ggcgcgcagatccgcctggtctgcggcaagagcgtggtggagttcaacgccgacggcacc
atcaatatctccggcagcgccttcaacctctacgccagcggcaacggcaacatcgacacc
ggcggccgcctcgacctcaattccggcggcgccagcgaggtcgacgccaagggcaagggc
gtgcagggcaccatcgacggccaggtacaggcgatgtttccgccgccggcgaagggctga

DBGET integrated database retrieval system