KEGG   Pseudomonas aeruginosa DK2: PADK2_00515
Entry
PADK2_00515       CDS       T02161                                 

Definition
(GenBank) hypothetical protein
Organism
pdk  Pseudomonas aeruginosa DK2
SSDB
Motif
Pfam: Tox-GHH2 DUF4150 DUF4423
Other DBs
NCBI-ProteinID: AFM62398
Position
119305..120465
AA seq 386 aa
MANEVYANNMEISCKAASGKSIAAFPDVCFTPPQAPPTPLGVPIPYPNTGLSKDTTKGTR
TIRITRKEVMLKNKSYYKTSYGDEPGRAPKKGIVTSKIKGKVYFTSWSMNVKFESKNVVR
HLDLTTHNHASFPGNTPVWPYLDQATVDAGGGPCSNEVKKEKKDCADFKPHGSKDACAGL
GAGKPSGKKTSNEADRLADKVAARKCLTARRCALQPYKPNSCCPQQTAHHLIEASALHDK
GRGGKGSVPLKGISNYSENKAPCVCAEGVNQNVGTHGLMHTFQSAAAAKSRSGTLQLSNG
SSISAKKTTYGTAKRQSMAAMGKVFPQSKCSKECLSAQLDNYHKQCGINARTPIKAVETG
QTDVTAATQAIKTRNARLGATRSRVR
NT seq 1161 nt   +upstreamnt  +downstreamnt
atggccaacgaggtgtacgccaacaacatggagatctcctgcaaggcggcgagcggcaag
tccatcgcggccttcccggatgtctgcttcaccccgccgcaggcgccgccgacgccgttg
ggggtaccgatcccctaccccaataccggcctgtccaaggacaccaccaaaggcacccgg
accattcgcatcacccgcaaggaggtgatgctgaagaacaagagctactacaagaccagc
tacggcgacgagccggggcgggcgccgaagaagggcatcgtcaccagcaagatcaagggc
aaggtgtacttcacctcctggtcgatgaacgtcaagttcgaaagcaagaacgtggttcgc
cacctcgacctgaccacccacaaccacgcgtcctttcctggcaatacgccggtctggccc
tacctcgaccaggccaccgtcgatgctggtggtggaccgtgcagcaatgaagtgaagaag
gagaagaaggattgcgctgacttcaagccgcatggcagcaaggatgcctgcgctggcctt
ggcgcgggcaagccttccggcaagaagaccagcaacgaagctgaccgactggcagacaag
gtcgctgcccgaaaatgcctgaccgcgcgccggtgtgccctgcaaccgtacaagccgaac
agttgctgcccgcagcagaccgctcaccacctgatcgaggccagcgccttgcacgacaag
ggacgtggtggaaaaggctcggtacccctcaaggggatatccaactattcggagaacaag
gctccttgcgtctgcgcggagggcgtcaatcagaacgtgggtacccacggcctcatgcac
acgttccagagcgccgctgccgcgaagtcgcgcagtggaaccctgcaattgtccaatggc
agctccatctccgcgaagaagaccacctacggaacggcgaaacgtcaatccatggctgcc
atgggcaaggtctttccgcagtcgaaatgctcgaaggaatgtctgtccgctcagctcgac
aactatcacaagcagtgcggaatcaacgccagaacacccatcaaggccgttgaaaccggc
cagaccgacgtcacggctgcgacgcaggcgataaagacccgcaatgcgcgtcttggcgcc
acgaggagtcgagtccgctag

DBGET integrated database retrieval system