KEGG   Pseudomonas aeruginosa DK2: PADK2_02425Help
Entry
PADK2_02425       CDS       T02161                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
pdk  Pseudomonas aeruginosa DK2
Pathway
pdk00620  Pyruvate metabolism
pdk00630  Glyoxylate and dicarboxylate metabolism
pdk01100  Metabolic pathways
pdk01110  Biosynthesis of secondary metabolites
pdk01120  Microbial metabolism in diverse environments
pdk01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pdk00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PADK2_02425
   00630 Glyoxylate and dicarboxylate metabolism
    PADK2_02425
Enzymes [BR:pdk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     PADK2_02425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: AFM62778
Structure
PDB: 

Position
complement(534145..536322)
Genome map
AA seq 725 aa AA seqDB search
MTERVQVGGLQVAKVLFDFVNNEAIPGTGVSADTFWTGAEAVINDLAPKNKALLAKRDEL
QAKIDGWHQARAGQAHDAAAYKAFLEEIGYLLPEAEDFQAGTQNVDDEIARMAGPQLVVP
VMNARFALNASNARWGSLYDALYGTDVISEEGGAEKGKGYNKVRGDKVIAFARAFLDEAA
PLESGSHVDATSYSVKNGALVVALKNGSETGLKNAGQFLAFQGDAAKPQAVLLKHNGLHF
EIQIDPSSPVGQTDAAGVKDVLMEAALTTIMDCEDSVAAVDADDKVVIYRNWLGLMKGDL
AEEVSKGGSTFTRTMNPDRVYTRADGSELTLHGRSLLFVRNVGHLMTNDAILDKDGNEVP
EGIQDGLFTSLIAIHDLNGNTSRKNSRTGSVYIVKPKMHGPEEAAFTNELFGRVEDVLGL
PRNTLKVGIMDEERRTTVNLKACIKAAKDRVVFINTGFLDRTGDEIHTSMEAGAVVRKGA
MKSEKWIGAYENNNVDVGLATGLQGKAQIGKGMWAMPDLMAAMLEQKIGHPLAGANTAWV
PSPTAATLHALHYHKVDVFARQAELAKRTPASVDDILTIPLAPNTNWTAEEIKNEVDNNA
QGILGYVVRWIDQGVGCSKVPDINDVGLMEDRATLRISSQLLANWLRHGVISQEQVVESL
KRMAVVVDRQNASDPSYRPMAPNFDDNVAFQAALELVVEGTRQPNGYTEPVLHRRRREFK
AKNGL
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacgcgttcaagtcggtggcctgcaggtcgccaaagtcctgttcgacttcgtg
aacaacgaagccatccccggaaccggcgtctctgccgacacgttctggaccggtgcggag
gccgtgatcaacgacctggcgccgaagaataaagccctgctcgccaagcgcgacgaactc
caggccaagatcgacggctggcaccaggctcgcgccggccaggcccacgacgcagctgcc
tacaaggccttcctcgaggaaatcggctacctgctgcccgaggcggaagacttccaggcc
ggcacccagaacgtcgacgacgagatcgcccgcatggccggcccgcagctggtggtgccg
gtgatgaatgcgcgcttcgccctcaacgcctccaacgcccgctggggctcgctgtacgac
gcactctacggcaccgacgtgatcagcgaagaaggcggcgccgagaaaggcaagggctac
aacaaggttcgcggcgacaaggtcatcgccttcgctcgcgccttcctcgacgaggccgcg
ccgctggagtccggctcccatgtcgacgccacttcctacagcgtgaagaacggcgcgctg
gtcgtcgcgctgaagaacggcagcgaaaccggcctgaagaatgctggccagttccttgcc
ttccagggcgacgccgccaagccgcaagcggtactgctcaagcacaacggcctgcacttc
gaaatccagatcgacccgagcagcccggtcggccagaccgatgccgcaggcgtgaaggac
gtgctgatggaagccgccctcaccaccatcatggactgcgaggactcggtcgccgcggtc
gacgccgacgacaaggtagtgatctaccgcaactggctgggcctgatgaaaggcgacctg
gccgaggaagtcagcaagggcggcagcaccttcacccgcaccatgaacccggaccgcgtc
tacaccagggccgacggttccgaactgaccctgcacggccgctcgctgctgttcgtgcgc
aacgtcggccacctgatgaccaacgatgcgatcctcgacaaggacggcaacgaagtgccg
gaaggcatccaggacggtctgttcaccagcctgatcgccattcatgacctgaacggcaac
accagccgcaagaacagccgcaccggcagcgtgtatatcgtcaagccgaagatgcacggt
ccggaagaagccgccttcaccaacgagctgttcggccgcgtcgaggacgtcctcggcctg
ccgcgcaacaccctgaaggtcggcatcatggacgaggagcgccgcaccaccgtgaacctg
aaggcctgcatcaaggcggccaaggatcgcgtggtgttcatcaacaccggcttcctcgac
cgcaccggcgacgagatccacacctccatggaagccggcgccgtggtgcgcaagggcgcc
atgaagtcggagaagtggatcggcgcctacgagaacaacaacgtcgacgtcggcctggcc
accggcctgcaaggcaaggcgcagatcggcaagggcatgtgggccatgcccgacctgatg
gccgccatgctcgagcagaagatcggccatccgctggccggcgccaacaccgcctgggtc
ccgtcgccgaccgccgcgaccctgcacgccctgcattaccacaaggtcgacgtgttcgcc
cgccaggccgagctggccaagcgcaccccggcctcggtggacgatatcctgaccattccg
ctggcgccgaacaccaactggaccgcggaagagatcaagaacgaggtggacaacaacgcc
cagggcatcctcggctatgtcgtccgctggatcgaccagggcgtcggctgctccaaggtg
ccggacatcaacgacgtcggtctgatggaagaccgcgccaccctgcgcatctccagccaa
ctgctggccaactggctgcgtcacggcgtgatcagccaggagcaggtggtcgagagcctc
aagcgcatggccgtggtggtcgaccggcagaacgccagcgacccgtcctaccggccgatg
gcgccgaacttcgacgacaacgtcgcgttccaggccgccctggagctggtggtggaaggc
acccggcagccgaacggctataccgagccggtcctgcatcgccgccgccgtgagttcaag
gcgaagaacgggctgtag

DBGET integrated database retrieval system