KEGG   Pseudomonas aeruginosa DK2: PADK2_06840
Entry
PADK2_06840       CDS       T02161                                 

Definition
(GenBank) hypothetical protein
Organism
pdk  Pseudomonas aeruginosa DK2
SSDB
Motif
Pfam: Glycos_trans_3N MukF_C
Other DBs
NCBI-ProteinID: AFM63661
Structure
PDB: 

Position
complement(1488993..1490219)
AA seq 408 aa
MTATSDLIESLISYSWDDWQVTRQEARRVIAAIRNDNVPDATIAALDKSGSLIKLFQRVG
PPELARSLIASIAGRTTMQRYQARNALIRSLINNPLGTQTDNWIYFPTITFFDICADLAD
AAGRLGFAAAGATGVASQAIQGPFSGVGATGVNPTDLPSIAFGDQLKLLNKDPATVTKYS
NPLGDLGAYLSQLSPQDKLNQAQTLVGQPISTLFPDAYPGNPPSRAKVMSAAARKYDLTP
QLIGAIILAEQRDQTRDEDAKVYQAAVSIKSANTSIGLGQVVVSTAIKYELFTDLLGQPV
RRGLSRKAVATLLASDEFNIFATARYIRYVANLASQQDLRKLPKTRGAFPSIDLRAYAGN
PRNWPRDNVRARASEYTSRPWDDNLSPGWPMFVDDAYATFLDPGMRFP
NT seq 1227 nt   +upstreamnt  +downstreamnt
atgaccgccaccagcgacctgatcgagtcactgatttcctatagctgggacgactggcag
gtgacccgccaggaagcccgccgggtgatcgccgcgatccgcaacgacaacgtgcccgat
gcgaccatcgccgcactcgacaagagcggctcgctgatcaagctgttccagcgggtgggc
ccgccggaactggcgcgctcgctgatcgccagcatcgccgggcgcaccaccatgcagcgc
taccaggcacgcaatgccttgatccgcagcctgatcaacaatcccctgggcacccagacc
gacaactggatctacttccccaccatcaccttcttcgacatctgcgccgacctcgccgac
gccgctggccgcctgggcttcgccgcggccggcgccaccggggtggccagccaggcgatc
cagggtccgttcagcggggtcggcgccaccggcgtcaatccgaccgacctgccgtccatt
gccttcggcgaccagctcaagctgctcaacaaggacccggcgaccgtcaccaagtacagc
aacccgctcggcgacctgggcgcctacctgagccagctttcgccgcaagacaagctgaac
caggcacagacgctggtcggccagccgatcagcacgctgttccccgacgcctatccgggc
aacccgccgtcgcgggccaaggtcatgtccgcggccgcgcgcaagtacgacctgacgccg
caactgatcggcgcgatcatcctcgccgagcagcgtgaccagacccgcgacgaagacgcc
aaggtctatcaggcggcagtcagcatcaagagcgccaacacctccatcggcctcggccag
gtggtggtctccaccgcgatcaagtacgagctgttcaccgacctgctcggccagccggtg
cgccgcggtctgtcgcgcaaggcggtcgccaccctgctggcttccgacgaattcaacatc
ttcgccaccgcccgttacatccgctacgtcgccaacctcgcgtcgcaacaggacctgcgc
aagctgccgaagacccgcggcgcatttccctccatcgatctccgcgcctacgccggcaat
ccgcgcaactggccgcgggacaatgtccgcgcgcgggcctcggaatacacctcgcggccc
tgggacgacaacctgtcgccgggctggccgatgttcgtcgacgatgcctacgccaccttc
ctcgaccctggaatgaggttcccatga

DBGET integrated database retrieval system