KEGG   Pseudomonas aeruginosa DK2: PADK2_12455Help
Entry
PADK2_12455       CDS       T02161                                 

Definition
(GenBank) putative AMP-binding enzyme
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pdk  Pseudomonas aeruginosa DK2
Pathway
pdk00010  Glycolysis / Gluconeogenesis
pdk00620  Pyruvate metabolism
pdk00640  Propanoate metabolism
pdk00680  Methane metabolism
pdk01100  Metabolic pathways
pdk01110  Biosynthesis of secondary metabolites
pdk01120  Microbial metabolism in diverse environments
pdk01130  Biosynthesis of antibiotics
pdk01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pdk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PADK2_12455
   00620 Pyruvate metabolism
    PADK2_12455
   00640 Propanoate metabolism
    PADK2_12455
  Energy metabolism
   00680 Methane metabolism
    PADK2_12455
Enzymes [BR:pdk01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PADK2_12455
Lipid biosynthesis proteins [BR:pdk01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PADK2_12455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AFM64774
Position
2629165..2630832
Genome map
AA seq 555 aa AA seqDB search
MRDYATTAAGFDLQRTAAATLSGTLQALNACVECCDRHALPGRIALFWEGKDGSRASYTF
SELKALSGRFANFLQAQGVRPGDCVAGLLPRTPELLVTILGAWRLGAVYQPLFTAFGPKA
IEHRVATAGSKVLVTDAANRDKLDELADPPLAVTVGGPKGQGIRRGDFSFWAELERYPAE
FEPVPRSGEDPFLMMFTSGTTGLAKPVPVPLKAILAFVGYLREAVDLRPEDAFWNLADPG
WAYGLYYAVAGPLAMGHPTTFYEGPFSVESTCRIIRDYGITNLAGSPTAYRLLMAAGAAA
ETALKGRLRAVSSAGEPLTPEVIRWFADRLGTTIHDHYGQTELGMVLCNHHALAHPVRVG
AAGFACPGHRVVVLDDDLNELPPGQPGILALDRRRSPLMWFPGYQGLETAAFVGDYYLSG
DTVELNEDGSISFVGRADDVITTSGYRVGPFDVESALIEHPAVMEAAVIGKPDPERTELV
KAFVVLCAGHRPTPELADALQRYVRQRLSAHAYPREIEFLEELPKTPSGKIQRFLLRNQE
IARQREAAPRAAAAN
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgactacgccaccactgccgccgggttcgacttgcagcggaccgccgccgccacg
ctttccggtacgctccaggcgctcaacgcctgcgtcgaatgctgcgaccggcatgccctg
ccgggacggatcgcgttgttctgggagggcaaggatggcagtcgcgccagctataccttc
agcgagctgaaagcgctctccggacgtttcgccaatttcctccaggcccagggcgtacgc
ccgggcgactgcgtcgccggcctgttgccgcgcacgcccgagcttctggtcaccatcctc
ggcgcctggcgcctgggcgcggtgtaccagccgctgttcaccgccttcggcccgaaggcc
atcgaacaccgcgtggcgaccgccggcagcaaggtgctggtcaccgatgcggccaaccgc
gacaagctcgacgaactcgccgatccgcctctggccgtcaccgtcggcggaccgaagggg
cagggcatccgtcgcggcgatttcagcttctgggccgagctggagcgctatccggccgaa
ttcgaaccggttccgcgcagcggcgaggatccgttcctgatgatgttcacctccggcacc
accggcctggccaaaccggtgccggtgccgctcaaggcgatcctcgccttcgtcggctac
ctgcgcgaggcggtggacctgcgccccgaggacgccttctggaacctcgccgatccgggc
tgggcctacggcctctactacgctgtcgccggtcccctcgccatgggccatccgaccacc
ttctacgaagggccgttcagcgtggaaagcacctgccggatcatccgtgactacggcatc
accaaccttgccggatcgcccaccgcctatcgcctgctgatggccgccggcgcggccgcg
gaaactgcgctgaaggggcgcctgcgcgcggtcagcagcgccggcgagccgttgaccccg
gaggtgatccgctggttcgccgacaggctcggcaccaccatccacgatcattacgggcag
accgagctgggcatggtgctgtgcaaccaccatgccctggcgcatccggtgcgggtcggc
gccgccgggttcgcctgtcccgggcaccgggtagtagtgctggacgacgatctcaacgaa
ctgccgcccggccagccaggcatcctcgccctcgaccggcggcgttcgccgctgatgtgg
tttcccggctaccagggcctggaaaccgcagccttcgtcggcgactactacctgagcggc
gataccgtcgaactcaacgaagacggcagcatcagcttcgtcggccgcgccgacgacgtc
attaccacctctggctaccgggtcggcccgttcgatgtggagagcgcgctgatcgaacac
ccggcagtgatggaggcggcggtgatcggcaagcccgacccggagcgcaccgaactggtc
aaggccttcgtcgtgctctgcgccggccaccggccgacgccggaactggcggacgcattg
cagcgatacgtgcgccagcgcctgtcggcgcacgcctacccgcgggagatcgagttcctc
gaggaactgccgaagactcccagcggcaagatccagcgctttctcctgcgcaaccaggag
atcgcccggcaacgcgaggcggccccacgggcggccgccgcgaactga

DBGET integrated database retrieval system