KEGG   Pseudomonas aeruginosa DK2: PADK2_12880Help
Entry
PADK2_12880       CDS       T02161                                 

Definition
(GenBank) putative glutathione S-transferase
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
pdk  Pseudomonas aeruginosa DK2
Pathway
pdk00350  Tyrosine metabolism
pdk00643  Styrene degradation
pdk01100  Metabolic pathways
pdk01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pdk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    PADK2_12880
  09111 Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    PADK2_12880
Enzymes [BR:pdk01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     PADK2_12880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 DUF599
Motif
Other DBs
NCBI-ProteinID: AFM64857
Structure
PDB: 

Position
complement(2726324..2726968)
Genome map
AA seq 214 aa AA seqDB search
MQLYSFFNSSTSYRVRIALALKGLDYQVVPVNLRQGEQLRPADRQRNPMGALPTLVDADG
RRFSQSLAIIDYLDAVQPEPSLIPLDPLHRAQALELALLVACDIHPLNNVRVLKYLTQVL
GIDAEDRQRWYAHWVAEGLAAAETLLNRHRRGAFFAGAAAGIVECCLVPQLANARRMGCD
LAPYPALLELEGRCLALEAFQRASPERQPDYLPD
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgcagctctacagcttcttcaacagctccacgtcctatcgggtgcgtatcgcattggcc
ctgaaaggcctggattaccaggtagtgccggtcaacctgcggcagggcgagcaactgcgc
ccggccgaccgccagcgcaacccgatgggcgcgctgccgaccctggtcgacgccgacggc
cgccggttcagccagtcgctggcgatcatcgactacctcgacgccgtgcagcccgaaccg
agcctgatccctctcgacccactgcatcgcgcccaggcgctggaactggccctgctggtg
gcctgcgacatccatccgctgaacaacgtgcgggtgctcaagtacctgacccaggtcctc
ggcatagacgccgaggaccgccagcgctggtacgcgcactgggtcgccgagggcctggcg
gcggcggagaccctgctgaaccgacaccgtcgcggcgccttcttcgccggcgccgcagcg
ggcatcgtcgagtgctgcctggtaccgcaactggccaacgcccggcgcatgggctgtgac
ctggcgccctacccggcgttgctcgaactggaggggcgctgcctggcgctcgaagccttc
cagcgcgccagccccgagcgccagcccgactacctgccggactga

DBGET integrated database retrieval system