KEGG   Pseudomonas aeruginosa DK2: PADK2_16435
Entry
PADK2_16435       CDS       T02161                                 

Definition
(GenBank) hypothetical protein
Organism
pdk  Pseudomonas aeruginosa DK2
SSDB
Motif
Pfam: CHAP NLPC_P60
Other DBs
NCBI-ProteinID: AFM65566
Structure
PDB: 

Position
3566062..3566526
AA seq 154 aa
MDSLDQCIVNACKNSWDKSYLAGTPNKDNCSGFVQSVAAELGVPMPRGNANAMVDGLEQS
WTKLASGAEAAQKAAQGFLVIAGLKGRTYGHVAVVISGPLYRQKYPMCWCGSIAGAVGQS
QGLKSVGQVWNRTDRDRLNYYVYSLASCSLPRAS
NT seq 465 nt   +upstreamnt  +downstreamnt
atggacagtctcgatcaatgcatcgtcaacgcctgcaagaacagctgggacaagagctac
ctggccggcaccccgaacaaggacaactgttccggcttcgtccagtcggtggccgccgag
ctgggcgtaccgatgccccgcggcaacgccaacgccatggtcgacggcctggagcagagc
tggaccaagctcgcctccggcgccgaggccgcgcagaaggcggcccaggggttcctggtg
atcgccggcctgaagggccgcacctacgggcacgtcgcggtggtcatcagcggtccgctg
tatcggcagaagtacccgatgtgctggtgcggcagcatcgccggagcggtcggccagagc
cagggcctgaagtcggtcggccaggtatggaatcgcaccgaccgcgaccgcctcaactac
tacgtctactccctggccagttgcagcctgcccagggccagttga

DBGET integrated database retrieval system