KEGG   Pseudomonas aeruginosa DK2: PADK2_16950Help
Entry
PADK2_16950       CDS       T02161                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
pdk  Pseudomonas aeruginosa DK2
Pathway
pdk00071  Fatty acid degradation
pdk00280  Valine, leucine and isoleucine degradation
pdk00281  Geraniol degradation
pdk00310  Lysine degradation
pdk00360  Phenylalanine metabolism
pdk00362  Benzoate degradation
pdk00380  Tryptophan metabolism
pdk00410  beta-Alanine metabolism
pdk00627  Aminobenzoate degradation
pdk00640  Propanoate metabolism
pdk00650  Butanoate metabolism
pdk00903  Limonene and pinene degradation
pdk00930  Caprolactam degradation
pdk01100  Metabolic pathways
pdk01110  Biosynthesis of secondary metabolites
pdk01120  Microbial metabolism in diverse environments
pdk01130  Biosynthesis of antibiotics
pdk01212  Fatty acid metabolism
Module
pdk_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pdk00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PADK2_16950
   00650 Butanoate metabolism
    PADK2_16950
  Lipid metabolism
   00071 Fatty acid degradation
    PADK2_16950
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PADK2_16950
   00310 Lysine degradation
    PADK2_16950
   00360 Phenylalanine metabolism
    PADK2_16950
   00380 Tryptophan metabolism
    PADK2_16950
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PADK2_16950
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PADK2_16950
   00281 Geraniol degradation
    PADK2_16950
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PADK2_16950
   00627 Aminobenzoate degradation
    PADK2_16950
   00930 Caprolactam degradation
    PADK2_16950
Enzymes [BR:pdk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PADK2_16950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AFM65669
Position
3680329..3681018
Genome map
AA seq 229 aa AA seqDB search
MSELISYQFEDGIATLTLNNGKVNAISPAVIDAFNQALDQALQDKAVVIVTGQPGILSGG
YDLKVMTSGPENAVNLVAAGSTLARRLLSHPYPVIVACPGHAVAKGAFLLLSADYRIGVD
GPFQIGLNEVAIGMTMHHVGIELARDRLRKSAFTRSVINAEMFSPAAAVDAGFLDTLVSA
DQLQESARAAAQQLKKLNMTAHRNTKLKVRKALLETLDQAIELDKKHLG
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagttgatcagctaccagttcgaagacggcatcgccaccctgaccctcaacaac
ggcaaggtgaacgccatctccccggcggtgatcgacgccttcaaccaggctctcgaccag
gccttgcaggacaaggccgtggtcatcgtcactggccagccgggcatcctctccggtggc
tacgacctgaaggtcatgacctccggcccggagaatgccgtcaacctggtcgccgccggc
tcgaccctggctcgccgcctgctctcccatccctacccggtgatcgtcgcctgccccggg
cacgcggtagccaagggcgccttcctgctgctctcggccgactaccggatcggcgtcgac
gggccgttccagatcggcctgaacgaagtcgccatcggcatgaccatgcaccatgtcggc
atcgaactggcccgcgatcgcctgcgcaagtcggcgttcacccgctcggtcatcaatgcc
gagatgttcagtccggccgctgcggtggatgccggcttcctcgacaccctggtcagcgcc
gaccagttacaggaaagcgcgcgtgcagcggcccagcagttgaagaaactcaacatgacc
gcgcaccgcaataccaagctcaaggtgcgcaaggcactgctggaaaccctcgaccaggcg
atcgagctggacaagaagcacctgggctaa

DBGET integrated database retrieval system