KEGG   Pseudomonas aeruginosa DK2: PADK2_24145Help
Entry
PADK2_24145       CDS       T02161                                 

Definition
(GenBank) pseudouridine synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
pdk  Pseudomonas aeruginosa DK2
Brite
KEGG Orthology (KO) [BR:pdk00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:pdk03009]
    PADK2_24145
Enzymes [BR:pdk01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     PADK2_24145
Ribosome biogenesis [BR:pdk03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    PADK2_24145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 TruB_N
Motif
Other DBs
NCBI-ProteinID: AFM67092
Position
complement(5192264..5193226)
Genome map
AA seq 320 aa AA seqDB search
MSDMIQRAAEVPFELGGQRLDQIAAQLFPEHSRSRLAGWIKDGRLTVDGAVLRPRDIVHS
GAQLVLEAEQEAQGEWLAQDIELEIVYEDEHILVIDKPAGLVVHPAAGHQDGTLLNALLY
HVPDIANVPRAGIVHRLDKDTTGLMVVAKTLEAHTKLVAQLQARSVSRIYEAIVIGVITS
GGTIDAPIGRHGVQRQKMAVVDAGKVAVSHYRVLERFRAHTHTRVKLETGRTHQIRVHMS
HIGYPLVGDPVYGGRFRIPPVASQTLVQTLREFPRQALHARFLELDHPATGVRMKWESPL
PEDFLWLLSLLRQDREAFVG
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatatgattcaacgcgcggccgaggtgccgttcgagctgggtggccagcgtctc
gaccagatcgccgcccagctttttcccgaacactcccgctcccgtctggccggctggatc
aaggacggacgcctgaccgtcgacggcgccgtgctgcgcccgcgcgacatcgtccacagc
ggcgcgcaactggtcctggaggccgagcaggaagcccagggcgagtggctcgcacaggac
atcgagctggaaatcgtctacgaggacgagcacatcctggtgatcgacaagcccgccggc
ctggtggtccatccggctgccggccatcaggacggcaccctgctgaatgccttgctctac
catgtcccggacatcgccaatgtgccgcgcgccgggatcgtccaccgcctggacaaggac
acgaccggcctgatggtggtggccaagacgctggaggcccacaccaagctggtggcgcaa
ctgcaggcacggtcggtcagccgcatctacgaggcgatcgtgatcggcgtgatcacctcc
ggcggcaccatcgatgcgccgatcggacggcatggcgtgcagcggcagaagatggcggtg
gtcgacgccggcaaggtggcggtcagccattaccgcgtgctggaacgcttccgtgcgcac
acccatacccgggtcaagctggagaccgggcgtacccaccagatccgcgtgcacatgagc
catatcggctatcccctggtcggcgatccggtctacggtgggcgcttcaggattcccccg
gtggccagccagaccctggtccagactcttcgcgagttcccccggcaggcgctgcacgcg
cgcttcctcgaactggatcacccggccaccggcgtgcgcatgaagtgggagtcgccgctg
ccggaagacttcctctggctgctcagcctgttgcgccaggatcgcgaggcgttcgtcgga
tga

DBGET integrated database retrieval system