KEGG   Pseudomonas aeruginosa DK2: PADK2_26940
Entry
PADK2_26940       CDS       T02161                                 

Definition
(GenBank) hypothetical protein
Organism
pdk  Pseudomonas aeruginosa DK2
SSDB
Motif
Pfam: PLDc_2 PLDc ABC_tran_CTD DUF3375
Other DBs
NCBI-ProteinID: AFM67651
Position
complement(5827018..5829255)
AA seq 745 aa
MSDLYKPQTLKLYAQQAGSVRLTLDWFANKAFYPPRAGVHIKPLINGQAAFDAVHAAMEA
ARHSIDIITWGFDPAMRFKRPDGPRIGELLQTKGREGVQARVLVWSNQLARLKENTIPGA
GVGGSGGTWAGSGVASGSAVDNEVLRLEQRRQHNLNLIARQQEALERSERLHREGRLPSF
DPRGAAHARTRIAELEAENAEIQRTLDSSGAQGYGGKRGSGGTRQDPWGQIFTRDWFKAV
RGGGLQNVEFRTRDFEQTARPVMNGEQVRLVNGRLQSLIHLLRADGIDDLGIGQLLVLTQ
FASHHQKMVLVDYGSPQAIGFVMGHNMHRNYWDTSAHLFDDRAAGRDPGFGPWQDISMQV
QGPVLADLSRNFSEAWDLETPWYKRWFSTPSLTAERDALPLPKIATPASNSVAQICRTQP
QDDERSILEHYLKALGNATDYVYMENQYFRYAGFAERLRKTAQVRKARGVPGDLYLFVVT
NTPDSSDASKTTYDMMKGLGQEQLMPQVQRDLAHDLREKREQLKQVRENLHPDPYVRRGQ
ENNIERLERKIEALEEKGVTPEVEQRLGDLGAQEIPGLAKNTGEDDKPYQLAEVPGLKVV
VATLATSDPAPGSPPPARLSAEAEAALGAPPLKARYKHIYVHSKLLLVDDLYTLLSSANI
NVRSMHGDSELGIAQPNPDLARAMREELWGLHAYEVAATTKDNFELWNQTMDKNWKQQRN
DEPLTSHLLRLWDVITPYSPSFTVD
NT seq 2238 nt   +upstreamnt  +downstreamnt
atgagcgacctgtacaaaccgcagaccctcaagctatacgcgcaacaggccggcagcgtc
cggctgaccctcgactggttcgccaacaaggctttctacccgccgcgcgcgggtgtgcac
atcaagccgctgatcaatggccaggcggccttcgacgcggtgcatgcggcgatggaagcg
gcccggcacagcatcgacatcatcacctggggcttcgacccggccatgcgcttcaaacgc
cccgacggaccgcgaatcggcgaattgctgcagacgaagggccgcgaaggagtgcaggcg
cgagtgctggtctggagcaaccaactcgccaggctcaaggaaaacaccatccccggggcc
ggcgtcggcggttccggcggcacctgggcgggctcgggcgtcgccagcggcagcgcagtg
gacaacgaggtgctgcgactggagcagcggcgccagcataacctcaacctcatcgcgcgg
cagcaggaagccctggagcgctcggaacggctgcaccgcgaaggcaggctgccgagcttc
gacccgcggggcgccgcccacgcgcggacgcgcatcgccgagctggaggcggagaacgcc
gagatccagcgcactctcgacagcagcggggcccagggctacggcggcaagcgcggttcc
ggcggcacccgccaggatccctgggggcagatattcacccgcgactggttcaaggcggta
cgcggcggtgggttgcagaacgtcgagttccgtacccgcgacttcgagcagacggccagg
ccggtgatgaacggcgagcaggtacgcctcgtcaatgggcgactgcaaagcctgatccac
ctgctgcgcgccgatggcatcgacgacctgggcatcggccagttgctggtactcacccag
ttcgccagccatcaccagaagatggtcctggtcgactatggcagcccgcaggccatcggc
ttcgtcatgggtcacaacatgcaccgcaactactgggacaccagcgcccacctgttcgac
gaccgcgccgccggtcgcgatcccgggttcgggccctggcaggatatctccatgcaggtc
cagggcccggtgctggccgacctcagccgcaacttcagcgaggcctgggacctcgagacg
ccgtggtacaagcgctggttctcgacgccatcgctgaccgccgagcgcgacgccttgccg
ctgccgaagatcgccacgcccgccagcaacagcgtcgcgcagatttgccggacccagccg
caggacgacgagcgctcgatcctggagcactatctcaaggccctgggcaatgccaccgac
tacgtctacatggaaaaccagtacttccgttatgccggcttcgccgagcgcctgcggaag
actgcgcaggtgcgcaaggcccggggcgtgcccggcgacctgtacctgttcgtcgtgacc
aacacccccgactccagcgacgcctcgaagaccacctacgacatgatgaaaggcctgggc
caggagcaactgatgccgcaggtacagcgcgacctggcgcatgacttgcgggaaaagcgg
gagcagttgaagcaggtcagggaaaacctacatcccgatccctatgtccggcgcggccag
gaaaacaacatcgaacggctggagcgcaagatcgaggcgctcgaagagaaaggcgtgacg
ccggaagtcgagcaacgcctcggcgatctcggcgcgcaggagattcccggactggcgaag
aacaccggcgaggacgacaagccctatcaactcgccgaagtacccggcctcaaggtggtc
gtcgccaccctggccaccagcgaccctgcccccggcagcccgccgccagcgcgcctgtcc
gccgaagccgaggccgccctcggggcaccgccgctgaaggcgcgctacaagcacatctac
gtgcactccaagctgctgctggtggacgacctctataccctgctcagctcggccaatatc
aatgtccgcagcatgcatggcgacagcgagttggggattgcccagcccaatccggatttg
gcgagggcgatgcgggaggagttgtggggactacatgcgtatgaagtggctgcaacaacc
aaggacaactttgaactttggaatcaaacaatggacaagaactggaaacagcagcgaaac
gatgaacctctcactagccatctattacggttatgggatgtcataacaccttatagcccg
agctttacggtggattaa

DBGET integrated database retrieval system