KEGG   Pseudomonas aeruginosa DK2: PADK2_28910Help
Entry
PADK2_28910       CDS       T02161                                 

Definition
(GenBank) pyruvate carboxylase subunit B
  KO
K01960  pyruvate carboxylase subunit B [EC:6.4.1.1]
Organism
pdk  Pseudomonas aeruginosa DK2
Pathway
pdk00020  Citrate cycle (TCA cycle)
pdk00620  Pyruvate metabolism
pdk01100  Metabolic pathways
pdk01120  Microbial metabolism in diverse environments
pdk01200  Carbon metabolism
pdk01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pdk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PADK2_28910
   00620 Pyruvate metabolism
    PADK2_28910
Enzymes [BR:pdk01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     PADK2_28910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl Biotin_lipoyl_2 RnfC_N HlyD_D23 PTS_EIIA_1 NQRA GCV_H
Motif
Other DBs
NCBI-ProteinID: AFM68043
Position
complement(6253468..6255291)
Genome map
AA seq 607 aa AA seqDB search
MSNTIQAKKTGVTDTILRDAHQSLLATRMRTEDMLPICDKLDRVGYWSLEVWGGATFDAC
VRFLKEDPWERLRKLKAALPNTRLQMLLRGQNLLGYRHYSDDVVRAFVAKAAVNGIDVFR
IFDAMNDVRNLRVSIEAVKAAGKHAQGTICYTTSPVHTIEAFVAQGKAMADMGVDSIAIK
DMAGLLTPYATGDLVKALKDALPLDVVVHSHDTAGVASMCQLKAVENGADRIDTAISSMA
WGTSHPGTESMVAALRGTPYDTGLDLELIQEIGMYFHAVRKKYHQFESEFTGVDTRVQVN
QVPGGMISNLANQLKEQGALNRMGEVLEEIPRVRADLGFPPLVTPTSQIVGTQAFFNVLA
GERYKTITNEVKLYLQGRYGKAPGEVNEQLRRQAIGSEEVIDVRPADLIKPELNKLRSEI
GNLAKSEEDVLTYAMFPDIGRKFLEEREAGTLKPEELLPIPTGKGVAAAGAEGTPTEFVI
DVHGETYRVDITGVGVKSDNKRHFYLSIDGMPEEVVFEPLNEYVAGSASGRKHASEPGHV
STTMPGNIVDVLVKEGDSVKAGQAVLITEAMKMETEVQAGIAGTVKAIHVAKGDRVNPGE
ILIEIAG
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacaccatccaagcgaagaagaccggcgtcaccgataccatcctgcgcgatgcc
caccagtcgctgctggcgacccgcatgcgcaccgaggacatgctgccgatctgcgacaag
ctcgaccgcgtcggctactggtcgctggaagtctggggcggcgccaccttcgacgcctgc
gtacgcttcctcaaggaagacccgtgggaacgcctgcgcaagctcaaggcggcgctgccc
aacacccgcctgcagatgctcctgcgcgggcagaacctgctcggctaccgccactacagc
gacgatgtggtgcgcgccttcgtggccaaggcggcggtcaacggcatcgacgtgttccgc
atcttcgacgcgatgaacgacgtgcgtaacctgcgcgtctccatcgaggcagtgaaggcc
gccggcaagcacgcccagggcaccatctgctacaccaccagcccggtgcacaccatcgag
gccttcgtcgcccagggcaaggcgatggccgacatgggcgtcgactccatcgccatcaag
gacatggccggcctgctcaccccctatgccaccggcgacctggtcaaggccctgaaggac
gccctgccgctggacgtggtggtgcattcccatgacaccgccggtgtcgccagcatgtgc
cagctcaaggccgtggaaaacggcgccgaccgtatcgacacggcgatctccagcatggcc
tggggcaccagccacccgggcaccgagtcgatggtcgcggcgctgcgcggtaccccctac
gacaccggcctggacctggagctgatccaggagatcggcatgtacttccacgcggtgcgc
aagaagtaccaccagttcgagagcgaattcaccggcgtggatacccgcgtgcaggtcaac
caggtgccgggcgggatgatttccaacctggccaaccagctcaaggagcagggcgcgctg
aaccgtatgggcgaggtgctcgaggaaatcccgcgggtccgcgccgacctcggtttcccg
ccgctggtgacgccgacttcgcagatcgtcggcacccaggcgttcttcaacgtgctcgcc
ggcgagcgctacaagaccatcaccaacgaagtgaagctgtacctgcagggccgttatggc
aaggcccccggcgaggtcaacgagcaactgcggcgccaggccatcggcagcgaggaagtc
atcgacgtgcgcccggccgacctgatcaagccggagctgaacaagctgcgcagcgagatc
ggcaacctggccaagtccgaggaagacgtactcacctacgcgatgttcccggacatcggg
cgcaagttcctcgaagagcgtgaggccggcaccctgaagcccgaggaactgctgccgatt
cccaccggcaagggcgtcgccgccgctggcgcggaaggcaccccgaccgagttcgtcatc
gacgtgcacggcgagacctaccgcgtcgacatcaccggggtcggcgtgaagagcgacaac
aagcggcacttctacctgtccatcgacggcatgccggaagaagtggtgttcgagccgctc
aacgaatatgtcgccggctccgccagcggccgcaagcatgccagcgagccgggccacgtc
agcaccaccatgccgggcaacatcgtcgacgtgctggtgaaggaaggcgatagcgtcaag
gccggccaggcggtgttgatcaccgaggcgatgaagatggaaaccgaggtccaggccggc
atcgccggtacggtcaaggcgatccacgtggccaagggcgaccgggtcaacccgggcgag
atcctgatcgagattgcgggctga

DBGET integrated database retrieval system