KEGG   Pseudomonas aeruginosa DK2: PADK2_29015Help
Entry
PADK2_29015       CDS       T02161                                 

Definition
(GenBank) oxidoreductase Rmd
  KO
K15856  GDP-4-dehydro-6-deoxy-D-mannose reductase [EC:1.1.1.281]
Organism
pdk  Pseudomonas aeruginosa DK2
Pathway
pdk00051  Fructose and mannose metabolism
pdk00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:pdk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    PADK2_29015
   00520 Amino sugar and nucleotide sugar metabolism
    PADK2_29015
Enzymes [BR:pdk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.281  GDP-4-dehydro-6-deoxy-D-mannose reductase
     PADK2_29015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase RmlD_sub_bind NAD_binding_4 3Beta_HSD Polysacc_synt_2
Motif
Other DBs
NCBI-ProteinID: AFM68064
Position
complement(6281043..6281957)
Genome map
AA seq 304 aa AA seqDB search
MTQRLFVTGLSGFVGKHLQAYLAAAHTPWALLPVPHRYDLLEPDSLGDLWPELPDAVIHL
AGQTYVPEAFRDPARTLQINLLGTLNLLQALKARGFSGTFLYISSGDVYGQVAEAALPIH
EELIPHPRNPYAVSKLAAESLCLQWGITEGWRVLVARPFNHIGPGQKDSFVIASAARQIA
RMKQGLQANRLEVGDIDVSRDFLDVQDVLSAYLRLLSHGEAGAVYNVCSGQEQKIRELIE
LLADIAQVELEIVQDPARMRRAEQRRVRGSHARLHDTTGWKPEITIKQSLRAILSDWESR
VREE
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
ttgactcagcgtctgttcgtcaccgggctctccggtttcgtaggcaagcatcttcaagct
tatctggcagcggcccacacgccgtgggcgctccttcccgtaccgcatcgttacgacctg
ctggagccggattcgctgggcgacctctggccggagctgccggatgcggtcatccacctg
gccgggcagacctacgtgccggaggccttccgcgatcctgcgcggaccctgcagatcaac
ctccttggcaccctgaacctgctccaggcgcttaaggcgcggggtttctccggtaccttc
ctgtacatcagctccggcgacgtctacggccaggtggccgaggcggcgttgccgatccac
gaggaactcatcccccacccgcgcaatccctatgcggtcagcaagctggcggccgagtcg
ctgtgcctgcagtggggtatcaccgaaggctggcgggtgctggtggcgcgaccgttcaac
catatcgggccggggcagaaggacagcttcgtgatcgccagcgccgcgcggcagatcgcc
cggatgaagcagggcttgcaggccaatcggctggaagtgggggacatcgacgtcagccgt
gatttcctcgatgtccaggacgtgctgtcagcctatctgcgcctgctctcccacggcgag
gcgggcgccgtctataacgtctgttccgggcaggagcagaagattcgcgagctgatcgaa
ctgctggcggacatcgcccaggtcgagctggaaatcgttcaggaccctgccaggatgcgc
cgggcggaacagcggcgggttcgcggcagccatgcgcgactgcacgacaccacgggctgg
aagcctgaaataaccataaaacagtccctgcgggcgatcctgtccgactgggagtcacgg
gtacgagaagaatga

DBGET integrated database retrieval system