KEGG   Pyrodictium delaneyi: Pyrde_1561Help
Entry
Pyrde_1561        CDS       T04114                                 

Definition
(GenBank) glycine cleavage system aminomethyltransferase T
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
pdl  Pyrodictium delaneyi
Pathway
pdl00260  Glycine, serine and threonine metabolism
pdl00630  Glyoxylate and dicarboxylate metabolism
pdl00670  One carbon pool by folate
pdl01100  Metabolic pathways
pdl01110  Biosynthesis of secondary metabolites
pdl01130  Biosynthesis of antibiotics
pdl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pdl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Pyrde_1561
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pyrde_1561
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Pyrde_1561
Enzymes [BR:pdl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     Pyrde_1561
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C HZS_alpha DUF390
Motif
Other DBs
NCBI-ProteinID: ALL01604
UniProt: A0A0P0N4S0
Position
complement(1561550..1562686)
Genome map
AA seq 378 aa AA seqDB search
MAKLRIPLYDVHKSLGAQFGEFAGWEAPINYTSVIEEHMAVRRTVGFFDLSHMGRLLLSG
SDATRVLDHLLPRDITSEEGMMVGPTAFLNERAGFKDDVMTYNLGADGWLVVPNAVNREK
IRGWLDEWIGKLGAQARVEDHTLDWVLFAIQGPRAAELMKKLGAPSEVLDLKVLRFRRNV
ELEAAGAQALIVSRSGWTGEDGFEIIAEASEGEKILLKAAELLKELDGRLCGLGARDSLR
MEVGFVLYGHEIDEETTPVDARYWWVFQPGPKQDCVGCQALREALRRGAAKVRVGLKLGK
KARIVPRQGDKIYIDDIEIGYVTSGAYSPMLKRSLAQAYIKPSHALMGLNVEIERRGKRY
KAKIVDFPLVQPSSSPPA
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
ttggctaagctgcgcatacccctatacgatgtccacaagagtcttggcgcacagtttggc
gagttcgcgggatgggaggcgccgataaactatacgagcgtcatagaggagcacatggcc
gtccgcaggactgtcgggttcttcgacctgagccacatgggtcgcctcctgctaagcggc
agcgacgctacgcgtgtcctagaccacctactgccccgcgacataacgtcggaggaaggc
atgatggttggtccgacggcgttcctcaacgagcgcgcaggcttcaaggacgacgtgatg
acctataacctcggcgccgatgggtggctcgtcgtccctaacgcggttaaccgtgagaag
atacgtggctggctagacgagtggataggaaagctcggagcccaggcacgggtcgaggac
cacaccctagactgggtgctcttcgccatccaggggccccgcgcggcagagctcatgaag
aaactgggagcgcccagcgaggtgctcgacctcaaggtactccgcttccgccgcaacgtg
gagctagaggcggcaggggcacaggcgctcatagtctcgcgtagtgggtggaccggcgag
gacggtttcgagataatagcagaggctagtgagggcgagaagatactgctcaaggcagcc
gagttgctaaaggagctagacggcaggctttgcgggctgggcgcgcgcgacagcctccgc
atggaggtaggcttcgtactctacggacacgagatagacgaggagactacaccggtagat
gccaggtactggtgggtattccagcccggccccaagcaggactgtgtaggctgccaggcg
ctccgcgaggcactacgccgcggcgcagcaaaggtacgtgttggcctcaagctcggcaag
aaggcccgcatagtgccacggcagggagacaagatatacatagacgatattgagataggc
tatgtgaccagtggagcctatagccccatgctgaagcggagtctagcacaggcctacatc
aagcctagccacgccttgatgggcctcaacgtggagatagagaggcgcggcaaacgctac
aaggcgaagatcgtggacttcccgctggtacagcctagctcaagcccaccagcttag

DBGET integrated database retrieval system