KEGG   Pyrodictium delaneyi: Pyrde_1567Help
Entry
Pyrde_1567        CDS       T04114                                 

Definition
(GenBank) Glutamate-1-semialdehyde aminotransferase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
pdl  Pyrodictium delaneyi
Pathway
pdl00860  Porphyrin and chlorophyll metabolism
pdl01100  Metabolic pathways
pdl01110  Biosynthesis of secondary metabolites
pdl01120  Microbial metabolism in diverse environments
Module
pdl_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:pdl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Pyrde_1567
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pdl01007]
    Pyrde_1567
Enzymes [BR:pdl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     Pyrde_1567
Amino acid related enzymes [BR:pdl01007]
 Aminotransferase (transaminase)
  Class III
   Pyrde_1567
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ALL01610
UniProt: A0A0P0N5M8
Position
complement(1565942..1567228)
Genome map
AA seq 428 aa AA seqDB search
MPGEQSKKLYEEALNLFPGGVNSPIRAAVKPYPFYVAKAEGPYLYTVDGERLIDYVLAYG
PMFLGHKHPQVMEAVKKQLENGWLYGTPGELEIELAKKILKYYHPGGMVRFVNTGTEATM
AAIRLARGYTGRKYIIKFNGCYHGAHDTVLVGAGSAAAEYGVPSSLGVPEEIAKLTLVAR
YNDLESVERIMKRHGDQVAAIIVEPVAGNAGVIPPKPGFLKGLRELADRYGALLIMDEVI
TGFRLGLGGAQEYYGVRGDLTTLGKIVGGGFPIGVVAGPREIMEKLTPSGKVFNAGTFNA
HPVTMAAGLATIEVLETGEPYRVAREAASKLVKVVEDLISRYDIKATVNYVENMFQVFFV
DGEVASPDDAMKSNRELYNKLHMELLKRGVFIAPSQMEAVFTSAAHTVEVVEETIRALEE
AFKRLREQ
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
ttgccgggtgaacagagcaagaagctctacgaagaagcattaaacttgttccctggaggc
gtcaacagtcctatacgtgcagcagtaaagccatacccgttctacgtcgctaaggccgag
ggcccgtacctctacacggttgatggtgagcgcctcatagactatgtacttgcatatggc
ccaatgttcctggggcataagcatccccaggtaatggaggctgtgaagaaacagcttgag
aatgggtggctctacggaactcccggcgagctggagatagaactggccaagaagatactc
aagtactatcaccctggcggcatggtgcgctttgttaacacaggtacagaggccactatg
gcagctataaggcttgcacggggttatacgggccgcaaatacataatcaagttcaatggt
tgttatcatggtgctcacgatacagtcctagttggtgctggtagtgcagcagcggagtat
ggtgtcccctcaagcctcggcgtgcccgaggagattgcaaagctaacgctagtagctcgt
tacaacgatctcgagagcgtagagaggatcatgaagaggcatggagaccaagtagcagca
ataatagtggagcccgtagcgggtaacgcgggcgtcataccgcctaagcccggcttcctc
aaggggctccgtgagctggcagacagatatggagctctcctcataatggatgaggttatc
acggggttccgcctaggcttaggtggtgcgcaagagtactacggggttcgcggcgaccta
acaaccctaggcaagatcgtcggtggaggcttccccatcggcgtagtggccgggccacgc
gagataatggaaaagctcacacctagcggcaaggtgttcaacgctggcacgttcaacgcc
cacccggttacaatggctgctggtctagctactatagaggtgctcgagactggagagccc
taccgtgtagcacgtgaagcggcatccaagctagtcaaggttgttgaagacctaattagc
cgctacgacataaaggctacagtgaactatgtggagaacatgttccaggtattcttcgtc
gacggtgaggtggcatcaccggacgacgctatgaagagcaaccgcgagctctacaacaag
ctccacatggagctgctaaagcgcggcgtcttcatagccccaagccagatggaggcagtc
ttcacgagcgcagcacacactgtcgaggtagtcgaggagaccataagggcgctcgaggag
gccttcaagaggctccgggagcaatga

DBGET integrated database retrieval system