KEGG   Pediococcus damnosus: ADU72_0770Help
Entry
ADU72_0770        CDS       T04321                                 

Definition
(GenBank) 5'-nucleotidase YjjG
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
pdm  Pediococcus damnosus
Pathway
pdm00625  Chloroalkane and chloroalkene degradation
pdm01100  Metabolic pathways
pdm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pdm00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ADU72_0770
   00361 Chlorocyclohexane and chlorobenzene degradation
    ADU72_0770
Enzymes [BR:pdm01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     ADU72_0770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase_like Hydrolase HAD PGP_phosphatase
Motif
Other DBs
NCBI-ProteinID: AMV66715
UniProt: A0A0R2HA34
Position
complement(623013..623693)
Genome map
AA seq 226 aa AA seqDB search
MKYQNLLFDVDDTLLDFHAAENQALKALFAEIKYPLTDDMVTYFRALNEHMWQRFELGQL
DRQTLVNTRFTKLFAHFNETVDGIKYEQIYREFLNQGHQLEPHALELLNSLKDQFNLFIV
SNGIGSVQQHRLNDSGLSTYFKHIFVSEEVGYQKPRIEFFDFIANHISGFTPKNALIIGD
SLTSDIQGGANAGIDSVWFNPALQPNHSSVSPTYQIDDLLDLKEIL
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatcagaatctattgtttgatgtggatgatacactattagattttcacgcagct
gagaaccaagcacttaaagcattgtttgcggaaattaaatatccactaacagatgacatg
gttacctattttcgagcactaaacgagcatatgtggcaacgttttgagcttggacaattg
gaccgccaaacactggttaacacgcgttttaccaaacttttcgcgcattttaatgaaaca
gttgatgggattaagtatgaacaaatttatcgcgaattcttaaatcaggggcaccaatta
gaaccccacgcgttagagttattaaatagtttaaaggatcagtttaatttattcattgtt
tcaaacggaatcgggtctgtgcagcagcatcgattaaacgactcaggattgagtacatac
tttaaacacatatttgtttccgaggaagttggttaccaaaaacctagaattgagttcttt
gattttattgctaatcatatttcggggtttacacccaaaaatgctttaataattggtgat
tcattgacttcagatattcaaggtggggctaacgcaggaattgattcggtatggtttaat
ccggcattacaaccgaaccattcatcagtgagcccaacgtatcagattgatgatttatta
gatctaaaggaaatattatag

DBGET integrated database retrieval system