KEGG   Pediococcus damnosus: ADU72_1018Help
Entry
ADU72_1018        CDS       T04321                                 

Definition
(GenBank) Glutathione peroxidase family protein
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pdm  Pediococcus damnosus
Pathway
pdm00480  Glutathione metabolism
pdm00590  Arachidonic acid metabolism
pdm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    ADU72_1018
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ADU72_1018
Enzymes [BR:pdm01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     ADU72_1018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin Pox_P4B
Motif
Other DBs
NCBI-ProteinID: AMV66957
UniProt: A0A143ARW2
Position
910657..911142
Genome map
AA seq 161 aa AA seqDB search
MSIYDYTVMLENGNTYSLSKYRGHPLIIVNTATKCGFAPQFKQLEQLYQQYKDQGLVVLG
FPSNQFKQEVATSEEAAAACRTTYGVSFPMHTIADVNGKNALPLFNYLTQSAPGALGSAI
KWNFTKFLVDSEGNVVKRYAPKTNPLKMTDEIEKVLSKNVK
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatatatgattacacagtaatgctagaaaacggcaatacctactcattatcaaaa
tatcgtggtcaccctttaattatcgtgaatacagcaactaaatgtggctttgccccgcaa
tttaaacaacttgaacaactctatcagcaatacaaagatcagggactggtcgtattggga
ttcccatctaaccaatttaaacaagaagttgctaccagtgaagaagccgctgcagcttgc
cgtacgacttatggagttagttttcccatgcacaccattgcggatgtcaacggcaaaaac
gccttacctttatttaattatttaacccaatctgctccaggcgccttgggctctgccatt
aaatggaacttcactaagtttttagtggattctgaaggcaatgttgtaaaacgttacgca
cccaaaaccaatcctttaaagatgacagatgaaatcgaaaaagtcctcagtaaaaacgta
aaataa

DBGET integrated database retrieval system