KEGG   Prevotella denticola: HMPREF9137_0089Help
Entry
HMPREF9137_0089   CDS       T01459                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pdn  Prevotella denticola
Pathway
pdn00480  Glutathione metabolism
pdn00590  Arachidonic acid metabolism
pdn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    HMPREF9137_0089
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    HMPREF9137_0089
Enzymes [BR:pdn01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     HMPREF9137_0089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AEA20388
UniProt: F2KZX9
Position
complement(98762..99310)
Genome map
AA seq 182 aa AA seqDB search
MRTVYEFSVKDRKGKEVSLKEYANEVLLIVNTATKCGFTPTYDQLEALYEKYHAQGFEVL
DFPCNQFGQQAPGTDESIHEFCKLTYGTEFPRFKKVKVNGDDADPLFKFLKEQKGFAGWD
ESHELYPVLDKMLSEADPDYKEKSDIKWNFTKFLINKKGQVVARFEPTEKIENIAKQIEA
LL
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgagaacagtttatgaattctctgtcaaggacagaaaaggaaaagaagtatcattgaaa
gagtatgccaacgaggtgctgctgattgtcaacacagctaccaagtgcggcttcacacct
acctacgaccagctggaagcactctatgagaagtaccatgcacagggttttgaggttctc
gatttcccctgcaaccagttcggacagcaggctccgggtaccgacgagagcatccatgag
ttctgcaagctcacctacggaacagaattcccgcgcttcaagaaagtgaaagtgaatggc
gacgatgccgatccgctcttcaagtttctcaaggagcagaagggatttgccggctgggac
gaatcgcacgagctttatcctgttctcgacaagatgctttctgaagctgatcctgactac
aaggagaaatctgatatcaaatggaacttcaccaagttcctgatcaacaagaaggggcag
gtcgtcgcccgctttgaaccgacagagaagatagagaatatcgctaagcagatcgaggct
ctgctgtag

DBGET integrated database retrieval system