KEGG   Prevotella denticola: HMPREF9137_0471Help
Entry
HMPREF9137_0471   CDS       T01459                                 

Definition
(GenBank) AMP-binding enzyme
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pdn  Prevotella denticola
Pathway
pdn00010  Glycolysis / Gluconeogenesis
pdn00620  Pyruvate metabolism
pdn00640  Propanoate metabolism
pdn00680  Methane metabolism
pdn01100  Metabolic pathways
pdn01110  Biosynthesis of secondary metabolites
pdn01120  Microbial metabolism in diverse environments
pdn01130  Biosynthesis of antibiotics
pdn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pdn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF9137_0471
   00620 Pyruvate metabolism
    HMPREF9137_0471
   00640 Propanoate metabolism
    HMPREF9137_0471
  Energy metabolism
   00680 Methane metabolism
    HMPREF9137_0471
Enzymes [BR:pdn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     HMPREF9137_0471
Lipid biosynthesis proteins [BR:pdn01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   HMPREF9137_0471
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AEA21068
UniProt: F2KV83
Position
complement(537437..539203)
Genome map
AA seq 588 aa AA seqDB search
MSLVSAGQMGISDLPTSRLLLFLKTNIQNNKMIERYLTQTQFSSEEDFREHLHFKVPDTF
NFAYDVMDEWAKEAPDKLALLWTSERGEEVKTTFAGFKEQTDRTAAYFLSLGISRGDKVM
LILKRHYQWWLAMMALCKIGAVAIPATHMLTTKDIVYRNRRASVKAIICVNDEYVTTQVR
QSVPESPTVEVLVAVNSMAQRDNPVPEGFHDWHKEWQEAPAFVRPEEVNTNGDTMLMYFT
SGTSGEPKMVAHDYLYALGHLVTGVFWHNLDENGIHLTVADTGWGKAVWGKLYGQWFAGA
TVFVYDHEKFTAGKIMRVMEKYRVTSFCAPPTIYRFMIQEDFAKYDLSALKYCTTAGEAL
EPAVYQKFFNLTGIRMMEGFGQTETTMTLGTFPWIKPKPGSMGKPNPQYDIRLLKPDGSA
CEDGEKGEICIDTSAGKPIGLFKGYYRDPELTERAWHDGLYYTGDIAWRDEDGYYWFVGR
ADDVIKSSGYRIGPFEVESALMTHPAVVECAVTGVPDVVRGMVVKATIVLADEWRSKAGD
ALVKELQNHVKHETAPYKYPRIIEFVDALPKTISGKIRRVEIREHDNR
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
gtgtctctggtatcggccgggcagatgggaatatcggatctgccaacgagccgcctgctt
ctatttttaaaaacgaatattcagaataacaagatgatagaaagatatttaacccagact
caattctcttcagaggaagatttccgagagcatctgcatttcaaagtccctgatactttc
aacttcgcttatgatgtcatggatgaatgggcaaaggaagcaccggacaaacttgcgctt
ctctggaccagtgagcgtggtgaagaggtaaagaccacctttgccggtttcaaggagcag
accgaccgtacagcggcttacttcctcagtcttggcatcagccgtggcgacaaggtgatg
ctcattctcaaacggcattaccagtggtggcttgccatgatggcgttgtgcaaaatcggt
gcggtggccatccccgctacccatatgcttacgacgaaggacattgtctaccgcaaccgg
cgtgcttccgtgaaggcaattatatgtgtgaacgatgaatatgtcacaacgcaggtcagg
cagtctgttccggagagtccgacggttgaagtgctcgtagccgtcaattccatggcgcag
agggataatcctgtgcccgagggatttcacgactggcataaggaatggcaggaggcaccg
gcattcgtccgtcctgaagaagtgaatacgaatggggatacgatgctgatgtatttcacc
agcggtaccagtggcgaaccgaagatggtggcgcatgattatctctatgcgctggggcat
ctcgtcacaggtgtcttctggcacaatctggacgagaacggcatccatcttaccgtggca
gatacgggatggggaaaggctgtctggggaaagctgtacgggcagtggtttgccggtgcg
acggtcttcgtttatgatcacgagaagttcacggcaggaaaaatcatgagagtgatggag
aaataccgtgtcacgtctttctgtgctccccccaccatctaccgtttcatgatacaggag
gatttcgcaaagtacgacctctctgcgctgaaatactgtaccacggccggcgaggcactt
gagcctgccgtttaccagaagttcttcaaccttacgggaatccggatgatggaaggtttc
ggacagaccgaaactaccatgacccttggtacattcccctggatcaaaccgaagccggga
agcatggggaagccgaacccgcagtatgacatcagactgctgaagccggacgggtctgcc
tgtgaggatggcgagaagggcgaaatctgcatcgataccagtgctggaaagccaatcggg
ctttttaaaggatattaccgtgatccggaactgacagagagggcatggcacgatggtctt
tattataccggcgacattgcctggcgagacgaggacggatattattggtttgtgggccgt
gccgatgatgtcattaaaagttcaggttatcgcattgggccgtttgaggtggaaagtgca
ttgatgacgcatccggctgttgttgagtgtgctgtgaccggcgtgcccgatgtggtgcgc
ggtatggtcgtcaaggcaaccattgttctcgctgacgaatggagaagcaaggcaggtgat
gctctcgtaaaagaactgcagaatcatgtcaagcatgaaacggcaccttacaagtaccct
cgtatcatcgagtttgtcgatgcccttccgaagactatctccggcaagattcgccgggtg
gagatccgtgaacacgataatcggtag

DBGET integrated database retrieval system