KEGG   Prevotella denticola: HMPREF9137_1030Help
Entry
HMPREF9137_1030   CDS       T01459                                 

Definition
(GenBank) firmicute fructose-1,6-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
pdn  Prevotella denticola
Pathway
pdn00010  Glycolysis / Gluconeogenesis
pdn00030  Pentose phosphate pathway
pdn00051  Fructose and mannose metabolism
pdn00680  Methane metabolism
pdn01100  Metabolic pathways
pdn01110  Biosynthesis of secondary metabolites
pdn01120  Microbial metabolism in diverse environments
pdn01130  Biosynthesis of antibiotics
pdn01200  Carbon metabolism
Module
pdn_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pdn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF9137_1030
   00030 Pentose phosphate pathway
    HMPREF9137_1030
   00051 Fructose and mannose metabolism
    HMPREF9137_1030
  Energy metabolism
   00680 Methane metabolism
    HMPREF9137_1030
Enzymes [BR:pdn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     HMPREF9137_1030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2 Metallophos Metallophos_2
Motif
Other DBs
NCBI-ProteinID: AEA20804
UniProt: F2KYB0
Position
complement(1210620..1212632)
Genome map
AA seq 670 aa AA seqDB search
MTNKHYNLKKDERYLQLLAKSFPNIADATTEIINLEAIAHLPKGTEHFLADIHGEYQAFQ
HVLKNASGNIKRKVNELFGDTLRSTEKRELCTLIYYPEQKLELVKHEEKDIKDWYHITIY
RLVEVCRDVSSKYTRSKVRKSLPADFSYIIQELLHEHSDDKDKTDYVSAIIKTIISTGRA
DDFITAICEVIQRLAIDQLHILGDVYDRGPGAHIVMDTLQNYHTWDITWGNHDILWMGAC
AGNDACICNVIRIALRYANMATIEDGYGINLIQLATFAMDVYGNDPCEEFMPKVSKDNPL
DDRNMTLTAQMHKAISIIQFKIESQMISRHPLWKMDDRRLLHAVDYKKGTIVVDGKEYKM
RSCNFPTINPEQPDQLTEEEQALIDRLHHSFTSSEKLRSHIQSLLRHGCMYNIVNHNLLY
HASIPLTKDGKLKEVEIAPGEKLKGKELLYQTGMKIRSAFQSNNDLQTEEEHQDAVDFFL
YLWCGPDSPLFDKAKMATFERYFLAEKETHKEEKGYYFSMRDNEQIVDMIMDEFHVPQPN
RHVINGHVPVHVVKGENPIKANGKLMVIDGGFSQAYHKETGIAGYTLVYHSRGFQLVQHE
PFTSAEDAIKRGTDIVSTTQIVEMNQHRLRVEDTDKGMELKLQIEALNELLYAYRCGFLT
EHERKTPPKA
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacaaacattacaatctgaagaaagacgagcggtatctgcagctgctggcaaaa
tcgttcccgaatattgccgatgccaccacggagattatcaaccttgaggccatcgcacac
ctcccgaaaggcacagagcacttccttgccgacatacacggtgaataccaggccttccaa
cacgtgctgaagaatgcctctggaaacatcaagcgaaaagtaaacgagctcttcggcgac
accctccgcagcacagagaagcgcgaactgtgtaccctgatctactatccggaacagaaa
ctggaactcgtcaaacacgaggaaaaggacataaaggactggtatcacatcaccatctac
cgtctggtagaggtgtgccgcgacgtgtccagtaaatacacccgctcgaaggtacgcaaa
tccttgccggcagatttctcctatatcatacaggagctgctgcacgaacattcggatgac
aaggacaagaccgactatgtgagcgccatcatcaagacgatcatctctaccggacgtgcc
gacgacttcattacggccatctgcgaagtcatacagcggctggccatcgaccagctgcac
attctgggcgatgtctacgaccgcggacctggtgcccacatcgtgatggacaccttgcag
aactaccacacatgggacatcacctgggggaaccacgacatcctgtggatgggagcctgt
gccggcaacgatgcttgcatctgcaacgtcatccgcatcgccctacgttatgccaacatg
gctaccatcgaagacggatacggcatcaacctcatccagctggccaccttcgccatggac
gtatacggcaatgacccctgtgaagagtttatgccgaaagtgtcgaaagacaacccgctt
gacgaccgcaacatgacgctgaccgcacagatgcacaaggccatcagcatcatacagttc
aagatagaatcgcagatgatcagccgtcatcctctatggaaaatggatgaccgccgcctg
ctccacgccgtcgactacaagaaaggaaccatcgtcgtggacggaaaagaatacaagatg
cgctcctgcaacttcccgaccatcaaccccgagcagcccgaccagctcaccgaggaggaa
caggcactcatcgaccggctgcaccattcgttcacatcaagcgaaaaactgcgcagccat
atccagtcgctgctccgccacggctgtatgtacaacatcgtcaaccacaacctgctctac
catgcctccatcccgcttacaaaagacggaaagctgaaagaggtggagatagcacccggg
gagaagctgaaagggaaggaactgctctaccagacaggcatgaagatccgttctgccttc
cagtcgaacaacgacctgcagaccgaggaagaacaccaggatgccgtcgacttcttcctc
tatctatggtgcggaccggacagtcccctcttcgacaaagccaagatggcgaccttcgaa
cgctatttccttgccgagaaggaaacccacaaggaagagaaaggctactatttcagtatg
cgcgacaacgaacagattgtcgacatgatcatggacgaattccatgtaccgcaacccaac
cgccacgtcatcaacggccatgttcccgtccatgtcgtcaagggcgagaaccctatcaag
gccaacggcaagctgatggtcatcgacgggggcttctcgcaggcctatcacaaggaaacc
ggaatagcaggctacaccctcgtctatcattcccgcggcttccagctcgtccagcacgag
ccgttcacgtcggctgaagatgccatcaaacgggggacagacattgtctcgacaacccag
atcgtagagatgaaccagcatcgcctccgcgtggaagacactgacaagggtatggaactg
aagctccagattgaagcgctcaacgaacttctctatgcctaccgctgcggtttcctcacc
gagcacgagcggaagacaccgcccaaggcataa

DBGET integrated database retrieval system