KEGG   Prevotella denticola: HMPREF9137_1884Help
Entry
HMPREF9137_1884   CDS       T01459                                 

Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
pdn  Prevotella denticola
Pathway
pdn00010  Glycolysis / Gluconeogenesis
pdn00052  Galactose metabolism
pdn01100  Metabolic pathways
pdn01110  Biosynthesis of secondary metabolites
pdn01120  Microbial metabolism in diverse environments
pdn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pdn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF9137_1884
   00052 Galactose metabolism
    HMPREF9137_1884
Enzymes [BR:pdn01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     HMPREF9137_1884
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AEA20391
UniProt: F2KW92
Position
2184399..2185517
Genome map
AA seq 372 aa AA seqDB search
MVNSEETQYVCGMRKEDFQTTIDGRETDLYVLRNARGNEVAITNYGGAIVAIMVPDRDGN
LANVIQGHDNIQDVISSPEPYLSTLIGRYGNRIARGRFQLNGKEYRIAVNNGPNALHGGK
KGFNAKVWDAVQVNDHAVVLKYTSPYGEEGFTGEVEVWVAYSFTDDDELVIKYSAKTNKK
TVINLTSHGFFSLAGIADPTPSVENLECQINADFYLPIDETSIPTGEILKVAGTPFDFRT
PKPVGQDINADDEQIRIGAGYDHCFVLNKKEEGELSFAARIREPESGRTMEVYTTEPGVQ
VYTDNWADGYKGQHGATFPRRSAICFEAQHFPDSPNRPYFPSVVLEPGREYTQKTVYKFG
VEKQTTHVETNK
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggtaaacagcgaagagacgcaatatgtctgcggcatgaggaaagaggatttccagacc
acgatagacggcagggagaccgacctctacgtactcagaaacgccaggggcaacgaagtt
gccatcaccaactacggcggggccatcgtcgccatcatggttcccgacagagacggcaat
ctggcgaacgtcatacagggacacgacaacatccaggacgtcatcagctccccggagcct
tatctctccaccctcatcggccgctacggcaaccgcattgccagaggacgcttccagctg
aacggcaaggaataccgcatcgctgtcaacaacggacccaacgcgctgcacggaggaaag
aaaggcttcaatgcaaaggtgtgggacgccgtccaggtaaacgaccatgccgtcgtactg
aagtacacgtctccctatggggaggaaggcttcaccggcgaggtggaagtatgggtagcc
tattcctttaccgacgacgacgagcttgtcatcaagtattcggcaaagaccaacaagaaa
accgtcatcaaccttaccagccacggattcttctccctggcaggcatcgccgaccctacc
ccgtcggtggaaaacctggaatgccagatcaacgccgacttctacctccccatcgacgag
acctccatcccgacaggcgaaatcctgaaggtggccggcacaccgttcgacttccgcaca
ccgaaaccggtcggacaggacatcaatgccgacgacgaacagataagaatcggcgcaggc
tacgaccactgcttcgtcctgaacaagaaggaggagggcgaactgtcgttcgcggcacgc
atcagagagccggagagcggcaggacaatggaggtctacaccaccgaaccgggcgtacag
gtatataccgacaactgggccgacggctacaaagggcagcacggggcgactttcccgcgc
cggagtgccatctgcttcgaggcgcagcacttccccgacagtcccaaccgcccttacttc
ccgtctgtcgtgctggagccgggcagggaatatacacagaagaccgtctataagttcggt
gtggagaaacagacaacccatgtagaaacaaacaaataa

DBGET integrated database retrieval system