KEGG   Penicillium digitatum: PDIP_02500Help
Entry
PDIP_02500        CDS       T04849                                 

Definition
(RefSeq) Succinyl-CoA synthetase beta subunit, putative
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
pdp  Penicillium digitatum
Pathway
pdp00020  Citrate cycle (TCA cycle)
pdp00640  Propanoate metabolism
pdp01100  Metabolic pathways
pdp01110  Biosynthesis of secondary metabolites
pdp01130  Biosynthesis of antibiotics
pdp01200  Carbon metabolism
Module
pdp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pdp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pdp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PDIP_02500
   00640 Propanoate metabolism
    PDIP_02500
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pdp04147]
    PDIP_02500
Enzymes [BR:pdp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     PDIP_02500
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     PDIP_02500
Exosome [BR:pdp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PDIP_02500
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2
Motif
Other DBs
NCBI-GeneID: 26228573
NCBI-ProteinID: XP_014538999
UniProt: K9GI06
Position
Unknown
AA seq 393 aa AA seqDB search
MITWRSIAHTLQRFKLPIPPGFLVTTPEQARHVVSVMNGPSVIKAQVLAGGRGKGNFNSD
GKSGVRRVESSSEAFKSASNMLGYYLTTAQTPEDGLRVDKLYINKAMAIAQEFYFAMILD
RQHTSPVLLISSSGGTDIESNIDNLHKLCFGLSTGITDEIDAYVQAELGFSDVEMKDIHR
ILVQMVKLFKEKDATLLELNPLVRTEEGEFVCLDAKFGFDDLARYRQEEIFALEKRSPEE
EEEHQLAKLGLSYVRLDGNIGNIVNGAGLAMATNDLISLQGGRCANFLDVGGAATKEALS
KALGILKSDQRIKGILINIYGGIVRCDMIAEAIVAAAAEMGGFKCPVVVRLQGTNSDKGL
KLIERSELDNLIVEAEFENAAQMIVKQTPGVEV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgattacttggcgttctatcgctcacaccttgcaacggttcaaactaccaattccaccg
gggttcctggttacaaccccagagcaagcaaggcatgttgtctccgtgatgaatggacca
tcagtgataaaagcccaagtcctcgcaggcggacgcggcaaaggtaacttcaacagcgat
gggaaaagtggggtccgacgtgtcgagtcatcaagcgaagcatttaaaagcgccagtaac
atgctcgggtactacctaaccacggcgcaaacaccagaggatggactccgcgttgacaag
ctctacatcaacaaagccatggccatcgctcaggaattctacttcgcaatgatactcgac
cgacaacacacctcacccgtgctattaatatcctcgtccggggggacagacattgaatcg
aacatcgacaacctgcacaaactctgctttgggctctcgacaggcatcactgacgaaatc
gatgcgtatgttcaagcagagctgggattctccgatgtcgagatgaaggacatacaccgg
atcttagtgcagatggtcaagttgttcaaggagaaagatgcgacgctacttgagttgaat
cccctggtgcgtacggaggaaggggaatttgtctgtttggatgccaagtttgggttcgat
gacctggcgcggtatcgacaagaggagatctttgcgttggagaagaggtcaccggaagag
gaggaggagcatcagctggcaaaattaggactttcttatgtgcgacttgatgggaatata
gggaacattgttaatggggctgggttggcgatggccactaatgatctgattagtctgcag
ggggggagatgtgcgaactttttagatgttgggggtgcggcgacgaaggaggctttgtcg
aaggctttggggattttgaagagtgatcagaggattaaggggattttgataaatatttat
gggggaattgtacgatgcgatatgattgccgaggcgattgttgctgctgctgctgagatg
gggggtttcaaatgtcccgttgtggttcggttgcagggtacgaattccgacaagggattg
aagctgattgaaagatccgagttggataacttgattgtagaagccgagttcgaaaatgct
gcccagatgatcgtgaagcaaacacccggggttgaagtttaa

DBGET integrated database retrieval system