KEGG   Penicillium digitatum: PDIP_12820Help
Entry
PDIP_12820        CDS       T04849                                 

Definition
(RefSeq) Ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
pdp  Penicillium digitatum
Pathway
pdp00220  Arginine biosynthesis
pdp01100  Metabolic pathways
pdp01110  Biosynthesis of secondary metabolites
pdp01130  Biosynthesis of antibiotics
pdp01230  Biosynthesis of amino acids
Module
pdp_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:pdp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    PDIP_12820
Enzymes [BR:pdp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     PDIP_12820
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OTCace_N OTCace Bac_rhamnosid
Motif
Other DBs
NCBI-GeneID: 26229605
NCBI-ProteinID: XP_014537895
UniProt: K9GFF4
Position
Unknown
AA seq 380 aa AA seqDB search
MASGLTAAARYGAQSVNQLAGSTSSLRRTLQANGIRRFAHQTPTLPPTSPFAPRHLLSIA
DLTPTEFATLVRNAASHKRSIKSGAIPENLLGSLSGKTVAMMFNKRSTRTRVSTEAATVQ
MGGHPMFLGKDDIQLGVNESLYDTSVVISSMVSCIVARVAKHEDVAGLAQHSTVPVINAL
CDSFHPLQIIADFLTIYESFPAQAHKLSSLGLEGLKIAWVGDANNVLFDLAIGATKMGVD
MAVATPKGYEIPAHMIEIIQRAGEGVTKPGKLTQTNVPEEAVKNADILVTDTWVSMGQEE
ETKKRMKAFEGFQITADLAKRGGAKEGWKFMHCLPRHPEEVNDEVFYSPRSLVFPEAENR
LWAAIAALEGFVVNKGKIVE
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggctagtggtctcacagctgccgcccgctatggcgcccaaagtgtaaaccaattggcc
ggctccacctcatctttgcgtcgaacactccaggctaatggaatccgacgatttgcccac
cagacaccgactttacctcccacctcccccttcgcccctcgtcaccttctctccatcgca
gatctgacccctacggaattcgccaccctggtccgcaacgctgcctcgcacaagcgttcc
atcaagtctggagccatcccggaaaacctactgggatccctttctggcaagaccgtggcc
atgatgttcaacaagcgcagcactcgtacccgtgtatccaccgaagccgccactgttcag
atgggtggccaccccatgttcctcggaaaggatgacatccagctcggtgtcaacgagtct
ctatacgatacctccgttgtgatttcgtctatggtttcttgtatcgttgcgcgtgttgcc
aagcacgaggacgttgcaggtttagcacagcactccaccgtgcctgtgatcaatgcgctg
tgtgactccttccacccgctccagattatcgccgacttcttgacaatctacgagtctttc
ccagctcaggcgcacaagctctccagcctgggtctggagggtcttaagattgcttgggtt
ggtgatgcgaacaacgttctgttcgatctggccattggcgctactaagatgggagtagac
atggctgttgctactcctaagggttatgagatccctgcccatatgattgaaattatccag
cgtgctggcgagggtgtcactaagcccggcaaactcacccagaccaatgttccggaggaa
gccgtgaagaacgccgacatcctagtgacggatacctgggtctccatgggccaggaggag
gaaaccaagaagcgtatgaaggcctttgagggcttccaaatcactgctgatttggctaag
cgcggtggcgctaaggaaggctggaagttcatgcactgcctgccccgccaccccgaggaa
gtgaatgacgaggtcttctacagcccccgctctctagtcttccctgaagccgaaaatcgt
ttgtgggcggccattgctgcgttggaaggcttcgttgtgaacaaaggaaaaattgtggag
taa

DBGET integrated database retrieval system