KEGG   Penicillium digitatum: PDIP_16270Help
Entry
PDIP_16270        CDS       T04849                                 

Definition
(RefSeq) Methionyl-tRNA synthetase, putative
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
pdp  Penicillium digitatum
Pathway
pdp00450  Selenocompound metabolism
pdp00970  Aminoacyl-tRNA biosynthesis
pdp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    PDIP_16270
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PDIP_16270
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pdp01007]
    PDIP_16270
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pdp03016]
    PDIP_16270
Enzymes [BR:pdp01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     PDIP_16270
Amino acid related enzymes [BR:pdp01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   PDIP_16270
Transfer RNA biogenesis [BR:pdp03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    PDIP_16270
 Prokaryotic type
   Other AARSs
    PDIP_16270
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1
Motif
Other DBs
NCBI-GeneID: 26229950
NCBI-ProteinID: XP_014537796
UniProt: K9H0X3
Position
Unknown
AA seq 499 aa AA seqDB search
MVIADIMKRWQVLLGNTDAQLLTGTDEHGMKIQQAAMQAGMDTQAFCDMNCRTFEALAKA
ANVDNDHFIRTTDPAHRDAVQYFWEMLQHRGYIYTAKHEGWYSISDETFYPQTQVQNSLD
PSTGRKRMVSIETGKEVEWSSETNYHFRLSAFKDRLLDLYKRENPFLTPTSYTAAVVNGI
ESGLQDLSISRPAERLTWGIPVPGDDTQTIYVWLDALVNYLTKAGYPFPPGKENKSVWPA
DLHVVGKDIVRFHCVYWPAFLMALDLPLPRNVLVHGHWTMNREKMSKSTGNVVNPFFAIE
RFGVDGMRFFLAYRGGLADDADFDNSFIIRDYKKLLQGGLGNLALRTIGCARGNLRSYIM
DAGSDKLPAATPDDLKHQEMLKQAPAQVAELLENLNPRAALQETMGIIEKTNKYFHAAEP
WKTPDSQRVIYNVAESLRIAGILLQPFMPGKSHDLLEMLRINTSDPSKRAFAATAYGSDQ
DYGEGVKKGILFPPLLTEE
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggtgatcgcggatatcatgaaacgttggcaggtcttgctcgggaacacggatgctcaa
ctgctgaccgggaccgacgagcatggaatgaagatccaacaagctgccatgcaagcggga
atggacacccaggcgttttgcgacatgaactgccgaacctttgaggccctagcgaaggct
gcaaacgtcgacaacgatcatttcatcaggaccaccgacccggcgcatagagatgccgtc
caatatttctgggaaatgctgcaacaccggggctacatttatactgcgaagcatgaaggt
tggtactccattagcgatgagacattctacccacagacgcaagtgcagaactccctagat
ccgtcaaccgggaggaaacgcatggtctcaatagaaacgggtaaagaggtagagtggtcc
tcagaaaccaactaccatttccgtctctcggccttcaaggatcgtttacttgacttgtac
aaaagagaaaatccgttcctcaccccgacctcctacacagctgctgtggtcaatggaatt
gagtcgggactgcaggatctctcgatttctcggcccgcagaacgtctgacttggggcatc
cctgttcccggcgatgacacgcagacaatctacgtgtggctagacgcgttggtcaactac
ttgaccaaagctggatatcctttcccacctggaaaagaaaacaaatctgtatggcccgca
gatttgcatgtagttggaaaagatattgttcgatttcattgcgtttactggcctgctttt
ctcatggcacttgatcttcccctacctcggaacgtcttggttcacggacactggacgatg
aatcgcgaaaaaatgtcgaagtccacaggcaatgttgtgaacccctttttcgccattgag
cggttcggagtcgatggcatgcgatttttccttgcgtaccggggtggccttgcggatgat
gcggactttgacaattcctttatcatccgagattacaagaaattgcttcagggggggctc
ggaaaccttgctctgcgtaccattggatgtgcgcgtggcaatttgcgctcgtacattatg
gacgccggatcggataagcttccagctgctactcctgacgacttgaaacatcaggaaatg
ttgaagcaggcgcctgcgcaggttgccgagcttctggagaatcttaacccgcgtgccgcg
ctgcaagaaactatgggcataattgagaagactaacaaatacttccatgcggcggagccg
tggaaaactcccgactcccaacgagtcatctacaacgtggcggaatcgctgcggatcgct
ggcattttgttgcaaccatttatgcctggcaagtctcatgatcttctagaaatgctccgt
ataaacacctcggacccgtccaagcgggcattcgcggccacggcgtacggttcggatcaa
gattacggtgagggcgttaagaaaggcatacttttccctcctttgctcactgaggagtaa

DBGET integrated database retrieval system