KEGG   Penicillium digitatum: PDIP_19470Help
Entry
PDIP_19470        CDS       T04849                                 

Definition
(RefSeq) hypothetical protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
pdp  Penicillium digitatum
Pathway
pdp00052  Galactose metabolism
pdp00500  Starch and sucrose metabolism
pdp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    PDIP_19470
   00500 Starch and sucrose metabolism
    PDIP_19470
Enzymes [BR:pdp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     PDIP_19470
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32C Glyco_hydro_32N
Motif
Other DBs
NCBI-GeneID: 26230270
NCBI-ProteinID: XP_014537123
UniProt: K9GZV8
Position
Unknown
AA seq 689 aa AA seqDB search
MKAATTASVLALIWERATAQDYNAPPPDLATLPELSLFETWRPHTHVLPPNGQIGDPCAH
YVDPETGRFHVGFLHNGTGIAAVLTEDLVHYYDVRPNGNFSIVAGGPNDPVAVFDGSVIP
RGVDDKPTLLYTSVSSLPIHWTLAYTRGSESQSLAVTYDGGKNFTKLDIPPVIPEPPVDV
NVTGFRDPYVFQNVDLDKSLGNTEGTWYTTISGGVHDVGPGLFLYQNTSPDFEQWEYLGE
WYNEPANSTWGNGDWSKVFGYNFETTNAFGLTREGYSYSGSPFMTIAVESSYVPIQPSVS
SLHAQLWLAGSIGVSEGENVTFTPDMVGVFDWGLASYAAAGKVVPQSSLPSTASGAPDRF
ISYVWLTGDVFGGIVGFPAAQQGWQNTLLTARELSIKAIPNVVNNDLVKETGSWRLTADS
DSAGECVELETLGIDIARETYSAMTDTPGFTEPGRTLTSAGVIPFTRSPDTKFFVLEAEI
SFDARASGLQTGFQILASELESTTIYYQFSNESIMIDRSKTSAAADTTSGIDASPESGRL
RLFDINDNCGNNSSDSGNGGSGGHGIYGGHGGQGGYAGHGDHKCGEKDEQGVHHSTDCKS
DPAPESDAHSSHSSEVGEEHIETLSLTIVVDNSVLEVYANSRFVLSTWVRPWYENSTEIR
FFQNGEGEASFNNIRVADGLYDAYPDRDQ
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgcaacgacagcatcggttttggccttgatctgggagagagccactgcacaa
gactacaacgctccgccccccgatctcgcgactctacctgaactctctttgttcgagaca
tggaggccccacacgcatgtgcttccaccaaacggccagattggcgatccatgcgcccac
tacgttgatcctgagacagggcgcttccacgtcggatttctccacaacggtactggaatc
gcggcagttctcacggaggatcttgttcattattacgatgtgagacccaatggcaacttc
tctatcgttgctggcggtcccaatgaccccgttgcggttttcgatggctctgtgatcccg
agaggagttgacgacaaaccgaccttgttatacacctctgtctcgtccttgccaatccat
tggacactggcttacacccgaggaagtgaatcacagtctctggccgtcacatacgacgga
ggaaagaactttaccaagctggatattccgcctgtgattcccgagcccccagtagacgtg
aatgtaacaggtttccgcgacccgtacgttttccaaaacgtggatctagacaaatctctt
ggaaataccgaaggtacttggtatacgaccatttcaggtggtgttcatgatgtcggacct
ggcctgttcctctaccagaacacgagccccgatttcgagcagtgggagtatcttggagaa
tggtacaatgagccggccaactcaacgtggggaaatggagactggtcaaaggtctttgga
tacaatttcgagactaccaacgcattcggcctcaccagagaaggttacagctacagcggc
agtcctttcatgaccattgcagtagagagctcatacgtgcccatccagccatcggtctct
tcactccatgcccagctttggctagcagggtcaattggagtctccgagggtgaaaacgtc
acattcacccctgatatggttggtgtctttgactggggcttggcttcttatgccgcagcg
ggcaaagttgttccccagtcttccctcccatctactgccagcggcgccccggaccgtttt
atcagctatgtgtggctcactggagatgttttcgggggaattgtgggcttcccagcggcg
caacaaggatggcaaaacactttgttgacggcgcgcgagttgtccatcaaagccattccc
aatgtggtcaacaacgatcttgtgaaggagacaggttcgtggcgtttaactgctgactcc
gactccgcgggtgagtgcgttgaacttgagacacttggaatcgacattgcccgggagacc
tacagtgctatgactgatactcctggcttcaccgagccaggccggacgctcacgagtgcc
ggtgtcattccctttactcgctccccggataccaagttctttgttctggaagctgagatc
agcttcgacgcacgtgcttctggcctgcaaaccggtttccagatcctggcatccgagctt
gagtcaaccactatttactaccagttctcaaatgagtccatcatgattgatcggtccaaa
accagcgctgctgcagacaccacctccggcatcgatgcgtcaccagagtctggacgtctt
cgtctatttgacatcaacgacaactgtggcaacaatagcagtgatagtggtaatggaggc
agcggtggccatgggatttacggtggtcacggcggccaaggtggctacgccggccacggc
gaccacaagtgtggtgaaaaggacgaacagggtgtgcatcattcgactgactgcaagtct
gaccctgcgccagaaagcgatgcccactcgtctcattccagcgaggttggtgaggagcac
attgagactctaagcctcaccatcgtggtggacaactctgtgctggaagtctacgcgaac
tctcgctttgtactgtccacctgggtccggccttggtacgaaaactctactgagattcgc
ttcttccaaaatggagagggtgaagcatctttcaacaacattcgcgttgctgatgggttg
tatgatgcttatccggaccgagaccaatga

DBGET integrated database retrieval system